Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5600.t1
Gene name
Locationscaffold_13:541385..543125
Strand+
Gene length (bp)1740
Transcript length (bp)1740
Coding sequence length (bp)1740
Protein length (aa) 580

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07519 Tannase Tannase and feruloyl esterase 6.5E-148 70 562

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 6.80 2.44 11.16
5d_25C Five days - 25 degrees Celsius 1.83 0.33 3.34
7d_25C Seven days - 25 degrees Celsius 1.11 0.00 2.28
10d_25C Ten days - 25 degrees Celsius 0.76 0.00 1.56
7d_15C Seven days - 15 degrees Celsius 0.36 0.00 0.85
7d_30C Seven days - 30 degrees Celsius 1.51 0.07 2.96

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.001278 yes
3d_25C 7d_30C 0.001804 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.392353 no
5d_25C 7d_15C 0.019886 yes
5d_25C 7d_30C 0.771661 no
5d_25C 10d_25C 0.106051 no
7d_25C 7d_15C 0.116163 no
7d_25C 7d_30C 0.665570 no
7d_25C 10d_25C 0.599425 no
7d_15C 7d_30C 0.040599 yes
7d_15C 10d_25C 0.320263 no
7d_30C 10d_25C 0.254454 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5600.t1
MRVSLGAAAALAASAGATSLADVCTVSNVQAALPSNGTLVGISMIPSAVTASAVYNATAGTGSTETYTYCNVTVT
YEHTGKGDSVVIKYAFPKPSDFKKRFYVAGGGGFSLSSDATGGLEYGAVSGATSAGYDAFNYAYDDIVLYGNGSI
NWDATYMFGYQALGEMTKIGKVLTQGFYGMSSSAKVYTYYEGCSDGGREGMSQVQRYGEEYDGAITGAPAFRFAQ
QQVHHVFPATAEQTLDYYPPPCELAKIVNATITACDPLDGRTDGVISRTDLCKLKFNLTSIIGEEYYCAAETSTS
LGFGFSKRADGTSTSTTPEQSGNVTAEGVKVAQAVYDGLHNSQGERAYLSWQIGSELSDADTQWNNESSKWEIDI
PSTGGEYVTKFIQLLDLDNLSDLDNVTYDTLVEWMNIGMVRYLDSLQTTLPDLTPFQASGGKLLHYHGESDPSIP
AASSVHYWQSVRAIMYPNLSSQESLKELADWYQFYLIPGAAHCGTNSLQPGPYPENNMQTMIDWVENGVKPSRLN
ATVSSGTYEGETQMLCQWPTRPLWKSNSTFKCVDDTASIESWTYSFPAFKLPVY*
Coding >Pro_DTO377G3_2|g5600.t1
ATGCGCGTCTCCTTGGGCGCTGCTGCAGCCCTGGCAGCATCAGCAGGTGCTACTTCCCTTGCTGATGTCTGTACC
GTCTCGAATGTGCAGGCTGCCCTGCCCTCCAACGGGACTCTAGTGGGTATCAGCATGATCCCCTCTGCTGTGACG
GCCAGTGCTGTCTACAATGCCACCGCTGGCACGGGAAGCACCGAGACTTATACCTACTGCAATGTGACCGTCACC
TACGAGCACACCGGCAAGGGAGACTCCGTTGTCATCAAGTATGCCTTCCCCAAGCCCTCCGATTTCAAGAAGCGC
TTCTACGTCGCCGGCGGCGGTGGCTTCTCTCTGTCCAGCGATGCAACCGGTGGTCTCGAGTACGGTGCTGTCAGC
GGTGCCACCAGCGCAGGCTATGATGCCTTCAACTACGCCTACGACGACATCGTCCTCTACGGCAACGGGAGCATC
AACTGGGACGCAACCTACATGTTCGGATACCAAGCCTTGGGCGAAATGACCAAGATCGGAAAGGTCCTGACCCAG
GGCTTCTATGGCATGTCTTCCTCCGCCAAGGTCTACACCTACTACGAAGGCTGCTCCGACGGCGGCCGCGAGGGC
ATGAGCCAAGTCCAGCGCTACGGAGAGGAATACGACGGAGCCATCACCGGAGCCCCGGCCTTCCGTTTCGCCCAG
CAGCAAGTCCACCACGTCTTCCCCGCTACAGCCGAGCAAACCCTCGACTACTACCCTCCTCCCTGCGAGCTGGCG
AAGATAGTCAACGCCACAATCACCGCCTGCGATCCCCTCGACGGCCGCACCGACGGCGTCATCTCCCGCACCGAC
CTCTGCAAGCTCAAATTCAACCTGACCTCCATCATCGGCGAGGAATACTACTGCGCCGCCGAAACCAGCACCTCC
CTAGGCTTCGGCTTCAGCAAGCGCGCCGACGGCACCAGCACCTCCACCACCCCCGAACAAAGCGGCAACGTCACC
GCCGAGGGCGTGAAAGTCGCACAAGCCGTCTACGACGGCCTGCACAACTCCCAAGGCGAGCGCGCCTACCTATCC
TGGCAAATCGGCTCCGAGCTCAGCGACGCCGACACGCAATGGAACAACGAATCCAGCAAGTGGGAGATCGACATC
CCCTCGACAGGCGGCGAGTACGTGACCAAGTTCATCCAGCTCCTCGACCTCGACAACCTCTCGGACCTCGACAAC
GTCACCTACGACACCCTCGTCGAGTGGATGAACATCGGCATGGTCCGCTACCTGGACAGTCTGCAAACCACCCTA
CCGGATCTCACGCCGTTCCAAGCCTCCGGCGGAAAACTGCTGCACTACCACGGCGAATCGGACCCCAGTATCCCT
GCTGCGTCGTCTGTGCATTACTGGCAGTCGGTGCGCGCGATCATGTACCCGAATCTGTCGTCCCAGGAGAGTCTG
AAGGAACTCGCCGATTGGTACCAATTCTACCTTATCCCTGGTGCGGCGCACTGCGGTACGAATTCTCTCCAGCCG
GGTCCGTACCCGGAGAATAATATGCAGACTATGATCGACTGGGTGGAGAATGGTGTTAAGCCTTCGCGGTTGAAT
GCCACTGTTTCGTCGGGTACTTATGAGGGCGAGACGCAGATGCTTTGCCAGTGGCCGACCCGTCCGCTTTGGAAG
AGTAATAGCACTTTCAAGTGTGTTGATGATACGGCTTCGATTGAGAGCTGGACTTATTCTTTCCCGGCTTTCAAG
CTGCCTGTGTACTAG
Transcript >Pro_DTO377G3_2|g5600.t1
ATGCGCGTCTCCTTGGGCGCTGCTGCAGCCCTGGCAGCATCAGCAGGTGCTACTTCCCTTGCTGATGTCTGTACC
GTCTCGAATGTGCAGGCTGCCCTGCCCTCCAACGGGACTCTAGTGGGTATCAGCATGATCCCCTCTGCTGTGACG
GCCAGTGCTGTCTACAATGCCACCGCTGGCACGGGAAGCACCGAGACTTATACCTACTGCAATGTGACCGTCACC
TACGAGCACACCGGCAAGGGAGACTCCGTTGTCATCAAGTATGCCTTCCCCAAGCCCTCCGATTTCAAGAAGCGC
TTCTACGTCGCCGGCGGCGGTGGCTTCTCTCTGTCCAGCGATGCAACCGGTGGTCTCGAGTACGGTGCTGTCAGC
GGTGCCACCAGCGCAGGCTATGATGCCTTCAACTACGCCTACGACGACATCGTCCTCTACGGCAACGGGAGCATC
AACTGGGACGCAACCTACATGTTCGGATACCAAGCCTTGGGCGAAATGACCAAGATCGGAAAGGTCCTGACCCAG
GGCTTCTATGGCATGTCTTCCTCCGCCAAGGTCTACACCTACTACGAAGGCTGCTCCGACGGCGGCCGCGAGGGC
ATGAGCCAAGTCCAGCGCTACGGAGAGGAATACGACGGAGCCATCACCGGAGCCCCGGCCTTCCGTTTCGCCCAG
CAGCAAGTCCACCACGTCTTCCCCGCTACAGCCGAGCAAACCCTCGACTACTACCCTCCTCCCTGCGAGCTGGCG
AAGATAGTCAACGCCACAATCACCGCCTGCGATCCCCTCGACGGCCGCACCGACGGCGTCATCTCCCGCACCGAC
CTCTGCAAGCTCAAATTCAACCTGACCTCCATCATCGGCGAGGAATACTACTGCGCCGCCGAAACCAGCACCTCC
CTAGGCTTCGGCTTCAGCAAGCGCGCCGACGGCACCAGCACCTCCACCACCCCCGAACAAAGCGGCAACGTCACC
GCCGAGGGCGTGAAAGTCGCACAAGCCGTCTACGACGGCCTGCACAACTCCCAAGGCGAGCGCGCCTACCTATCC
TGGCAAATCGGCTCCGAGCTCAGCGACGCCGACACGCAATGGAACAACGAATCCAGCAAGTGGGAGATCGACATC
CCCTCGACAGGCGGCGAGTACGTGACCAAGTTCATCCAGCTCCTCGACCTCGACAACCTCTCGGACCTCGACAAC
GTCACCTACGACACCCTCGTCGAGTGGATGAACATCGGCATGGTCCGCTACCTGGACAGTCTGCAAACCACCCTA
CCGGATCTCACGCCGTTCCAAGCCTCCGGCGGAAAACTGCTGCACTACCACGGCGAATCGGACCCCAGTATCCCT
GCTGCGTCGTCTGTGCATTACTGGCAGTCGGTGCGCGCGATCATGTACCCGAATCTGTCGTCCCAGGAGAGTCTG
AAGGAACTCGCCGATTGGTACCAATTCTACCTTATCCCTGGTGCGGCGCACTGCGGTACGAATTCTCTCCAGCCG
GGTCCGTACCCGGAGAATAATATGCAGACTATGATCGACTGGGTGGAGAATGGTGTTAAGCCTTCGCGGTTGAAT
GCCACTGTTTCGTCGGGTACTTATGAGGGCGAGACGCAGATGCTTTGCCAGTGGCCGACCCGTCCGCTTTGGAAG
AGTAATAGCACTTTCAAGTGTGTTGATGATACGGCTTCGATTGAGAGCTGGACTTATTCTTTCCCGGCTTTCAAG
CTGCCTGTGTACTAG
Gene >Pro_DTO377G3_2|g5600.t1
ATGCGCGTCTCCTTGGGCGCTGCTGCAGCCCTGGCAGCATCAGCAGGTGCTACTTCCCTTGCTGATGTCTGTACC
GTCTCGAATGTGCAGGCTGCCCTGCCCTCCAACGGGACTCTAGTGGGTATCAGCATGATCCCCTCTGCTGTGACG
GCCAGTGCTGTCTACAATGCCACCGCTGGCACGGGAAGCACCGAGACTTATACCTACTGCAATGTGACCGTCACC
TACGAGCACACCGGCAAGGGAGACTCCGTTGTCATCAAGTATGCCTTCCCCAAGCCCTCCGATTTCAAGAAGCGC
TTCTACGTCGCCGGCGGCGGTGGCTTCTCTCTGTCCAGCGATGCAACCGGTGGTCTCGAGTACGGTGCTGTCAGC
GGTGCCACCAGCGCAGGCTATGATGCCTTCAACTACGCCTACGACGACATCGTCCTCTACGGCAACGGGAGCATC
AACTGGGACGCAACCTACATGTTCGGATACCAAGCCTTGGGCGAAATGACCAAGATCGGAAAGGTCCTGACCCAG
GGCTTCTATGGCATGTCTTCCTCCGCCAAGGTCTACACCTACTACGAAGGCTGCTCCGACGGCGGCCGCGAGGGC
ATGAGCCAAGTCCAGCGCTACGGAGAGGAATACGACGGAGCCATCACCGGAGCCCCGGCCTTCCGTTTCGCCCAG
CAGCAAGTCCACCACGTCTTCCCCGCTACAGCCGAGCAAACCCTCGACTACTACCCTCCTCCCTGCGAGCTGGCG
AAGATAGTCAACGCCACAATCACCGCCTGCGATCCCCTCGACGGCCGCACCGACGGCGTCATCTCCCGCACCGAC
CTCTGCAAGCTCAAATTCAACCTGACCTCCATCATCGGCGAGGAATACTACTGCGCCGCCGAAACCAGCACCTCC
CTAGGCTTCGGCTTCAGCAAGCGCGCCGACGGCACCAGCACCTCCACCACCCCCGAACAAAGCGGCAACGTCACC
GCCGAGGGCGTGAAAGTCGCACAAGCCGTCTACGACGGCCTGCACAACTCCCAAGGCGAGCGCGCCTACCTATCC
TGGCAAATCGGCTCCGAGCTCAGCGACGCCGACACGCAATGGAACAACGAATCCAGCAAGTGGGAGATCGACATC
CCCTCGACAGGCGGCGAGTACGTGACCAAGTTCATCCAGCTCCTCGACCTCGACAACCTCTCGGACCTCGACAAC
GTCACCTACGACACCCTCGTCGAGTGGATGAACATCGGCATGGTCCGCTACCTGGACAGTCTGCAAACCACCCTA
CCGGATCTCACGCCGTTCCAAGCCTCCGGCGGAAAACTGCTGCACTACCACGGCGAATCGGACCCCAGTATCCCT
GCTGCGTCGTCTGTGCATTACTGGCAGTCGGTGCGCGCGATCATGTACCCGAATCTGTCGTCCCAGGAGAGTCTG
AAGGAACTCGCCGATTGGTACCAATTCTACCTTATCCCTGGTGCGGCGCACTGCGGTACGAATTCTCTCCAGCCG
GGTCCGTACCCGGAGAATAATATGCAGACTATGATCGACTGGGTGGAGAATGGTGTTAAGCCTTCGCGGTTGAAT
GCCACTGTTTCGTCGGGTACTTATGAGGGCGAGACGCAGATGCTTTGCCAGTGGCCGACCCGTCCGCTTTGGAAG
AGTAATAGCACTTTCAAGTGTGTTGATGATACGGCTTCGATTGAGAGCTGGACTTATTCTTTCCCGGCTTTCAAG
CTGCCTGTGTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail