Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5596.t1
Gene name
Locationscaffold_13:532789..533881
Strand-
Gene length (bp)1092
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 4.6E-15 38 183
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 9.7E-07 48 171
PF08659 KR KR domain 3.9E-05 39 132

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 37.80 19.82 55.77
5d_25C Five days - 25 degrees Celsius 27.12 12.76 41.48
7d_25C Seven days - 25 degrees Celsius 23.37 10.37 36.37
10d_25C Ten days - 25 degrees Celsius 13.72 5.06 22.38
7d_15C Seven days - 15 degrees Celsius 22.37 8.52 36.22
7d_30C Seven days - 30 degrees Celsius 33.45 16.55 50.35

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.258071 no
3d_25C 7d_25C 0.093559 no
3d_25C 7d_15C 0.077004 no
3d_25C 7d_30C 0.741301 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.703407 no
5d_25C 7d_15C 0.619296 no
5d_25C 7d_30C 0.539933 no
5d_25C 10d_25C 0.020660 yes
7d_25C 7d_15C 0.929334 no
7d_25C 7d_30C 0.255376 no
7d_25C 10d_25C 0.092061 no
7d_15C 7d_30C 0.213479 no
7d_15C 10d_25C 0.143891 no
7d_30C 10d_25C 0.001804 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5596.t1
MGSKFDVTPEKQASLPRFFYNQITVKPAPVKGVSLEGKTALVTGSNIGVGLETSRQLLDLGLSKLILAVRSDEKG
QAAKKDLAAGRDLSDDSIEVWKLDQSDYDSVVAFAERTKSLPRLDIVVLNIGIANATRVFNAKTGHDEMIQVNYL
STALLAILLLPVVKEKRAAQGGPSRITIVSSEVAAWTPFKEKKSFPLLAALDQKKTKVDPLDRMMVSKLLGQFFL
AHLASVVPPSVAIINATSPGSVFDSEFNREHDKTFAGAIAKIVMRRMANTAAVGARMVTDAAVNHGEETHGEFLS
FQKLVPLAPIIYSEEGKKISEQLWKETSEELAFANVDEILKTISE*
Coding >Pro_DTO377G3_2|g5596.t1
ATGGGGTCCAAATTCGATGTGACTCCGGAAAAGCAGGCCAGCCTGCCTCGCTTCTTCTACAACCAGATTACCGTG
AAACCCGCCCCGGTCAAGGGAGTCAGCCTGGAGGGCAAGACCGCCCTGGTGACCGGATCCAACATCGGCGTCGGC
CTGGAGACCAGTCGCCAGCTCCTCGACCTGGGACTCAGCAAGCTCATTCTCGCTGTGCGCAGTGACGAGAAAGGC
CAGGCGGCTAAAAAGGATCTAGCCGCTGGCCGGGATCTCTCCGACGATAGCATCGAGGTCTGGAAGCTTGACCAG
TCCGACTATGACTCTGTCGTCGCCTTTGCGGAGCGCACCAAGAGCCTCCCCCGACTAGACATTGTCGTCCTGAAT
ATCGGCATTGCCAACGCCACGCGCGTCTTCAACGCCAAGACAGGCCATGATGAGATGATCCAGGTGAACTACCTC
TCCACCGCCCTGCTGGCAATCCTCCTGCTCCCTGTCGTCAAGGAAAAACGCGCTGCCCAAGGAGGTCCGAGCCGC
ATTACGATCGTCTCATCAGAGGTCGCCGCATGGACTCCCTTCAAGGAGAAGAAAAGCTTCCCGCTGCTGGCAGCG
CTCGACCAGAAGAAGACCAAGGTTGACCCCCTCGATCGCATGATGGTCTCTAAGCTTCTAGGGCAGTTTTTCCTG
GCACATCTGGCCTCGGTTGTCCCGCCTTCCGTTGCCATCATCAATGCCACCTCGCCGGGCTCTGTCTTCGATTCC
GAATTCAACCGTGAGCACGATAAGACTTTCGCCGGAGCTATCGCCAAGATCGTAATGCGCCGCATGGCCAACACT
GCTGCTGTTGGAGCCCGAATGGTCACCGATGCAGCTGTCAACCATGGCGAGGAGACCCATGGCGAGTTCCTGTCC
TTCCAGAAATTGGTGCCTTTGGCACCGATTATCTACAGCGAAGAGGGGAAGAAGATCTCAGAGCAGCTCTGGAAA
GAGACCAGCGAAGAGCTCGCCTTTGCGAATGTGGATGAGATTCTCAAGACTATTTCAGAATAA
Transcript >Pro_DTO377G3_2|g5596.t1
ATGGGGTCCAAATTCGATGTGACTCCGGAAAAGCAGGCCAGCCTGCCTCGCTTCTTCTACAACCAGATTACCGTG
AAACCCGCCCCGGTCAAGGGAGTCAGCCTGGAGGGCAAGACCGCCCTGGTGACCGGATCCAACATCGGCGTCGGC
CTGGAGACCAGTCGCCAGCTCCTCGACCTGGGACTCAGCAAGCTCATTCTCGCTGTGCGCAGTGACGAGAAAGGC
CAGGCGGCTAAAAAGGATCTAGCCGCTGGCCGGGATCTCTCCGACGATAGCATCGAGGTCTGGAAGCTTGACCAG
TCCGACTATGACTCTGTCGTCGCCTTTGCGGAGCGCACCAAGAGCCTCCCCCGACTAGACATTGTCGTCCTGAAT
ATCGGCATTGCCAACGCCACGCGCGTCTTCAACGCCAAGACAGGCCATGATGAGATGATCCAGGTGAACTACCTC
TCCACCGCCCTGCTGGCAATCCTCCTGCTCCCTGTCGTCAAGGAAAAACGCGCTGCCCAAGGAGGTCCGAGCCGC
ATTACGATCGTCTCATCAGAGGTCGCCGCATGGACTCCCTTCAAGGAGAAGAAAAGCTTCCCGCTGCTGGCAGCG
CTCGACCAGAAGAAGACCAAGGTTGACCCCCTCGATCGCATGATGGTCTCTAAGCTTCTAGGGCAGTTTTTCCTG
GCACATCTGGCCTCGGTTGTCCCGCCTTCCGTTGCCATCATCAATGCCACCTCGCCGGGCTCTGTCTTCGATTCC
GAATTCAACCGTGAGCACGATAAGACTTTCGCCGGAGCTATCGCCAAGATCGTAATGCGCCGCATGGCCAACACT
GCTGCTGTTGGAGCCCGAATGGTCACCGATGCAGCTGTCAACCATGGCGAGGAGACCCATGGCGAGTTCCTGTCC
TTCCAGAAATTGGTGCCTTTGGCACCGATTATCTACAGCGAAGAGGGGAAGAAGATCTCAGAGCAGCTCTGGAAA
GAGACCAGCGAAGAGCTCGCCTTTGCGAATGTGGATGAGATTCTCAAGACTATTTCAGAATAA
Gene >Pro_DTO377G3_2|g5596.t1
ATGGGGTCCAAATTCGATGTGACTCCGGAAAAGCAGGCCAGCCTGCCTCGCTTCTTCTACAACCAGATTACCGTG
AAACCCGCCCCGGTCAAGGGAGTCAGCCTGGAGGGCAAGACCGCCCTGGTGACCGGATCCAACATCGGCGTCGGC
CTGGAGACCAGTCGCCAGCTCCTCGACCTGGGACTCAGCAAGCTCATTCTCGCTGTGCGCAGTGACGAGAAAGGC
CAGGCGGCTAAAAAGGATCTAGCCGCTGGCCGGGATCTCTCCGACGATAGCATCGAGGTCTGGAAGCTTGACCAG
TCCGACTATGACTCTGTCGTCGCCTTTGCGGAGCGCACCAAGAGCCTCCCCCGACTAGACATTGTCGTCCTGAAT
ATCGGCATTGCCAACGCCACGCGCGTCTTCAACGCCAAGACAGGCCATGATGAGATGATCCAGGTGAACTACCTC
TCCACCGCCCTGCTGGCAATCCTCCTGCTCCCTGTCGTCAAGGAAAAACGCGCTGCCCAAGGAGGTCCGAGCCGC
ATTACGATCGTCTCATCAGAGGTCGCCGCATGGACTCCCTTCAAGGAGAAGAAAAGCTTCCCGCTGCTGGCAGCG
CTCGACCAGAAGAAGACCAAGGTTGACCCCCTCGATCGCATGATGGTCTCTAAGCTTCTAGGGCAGTTTTTCCTG
GCACATCTGGCCTCGGTTGTCCCGCCTTCCGTTGCCATCATCAATGCCACCTCGCCGGGCTCTGTCTTCGATTCC
GAATTCAACCGTGAGCACGATAAGACTTTCGCCGGAGCTATCGCCAAGATCGTAATGCGCCGCATGGCCAACACT
GCTGCTGTTGGAGCCCGAATGGTCACCGATGCAGCTGTCAACCATGGCGAGGAGACCCATGGCGAGTTCCTGTCC
TTCCAGAAATTGGTGCCGTAAGTTATCCCTATGTTGACCATGATTAGAGCTATTGCTAAGATACTTTACAGTTTG
GCACCGATTATCTACAGCGAAGAGGGGAAGAAGATCTCAGAGCAGCTCTGGAAAGAGACCAGCGAAGAGCTCGCC
TTTGCGAATGTGGATGAGATTCTCAAGACTATTTCAGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail