Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5585.t1
Gene name
Locationscaffold_13:504814..506013
Strand+
Gene length (bp)1199
Transcript length (bp)795
Coding sequence length (bp)795
Protein length (aa) 265

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03947 Ribosomal_L2_C Ribosomal Proteins L2, C-terminal domain 1.5E-42 108 234
PF00181 Ribosomal_L2 Ribosomal Proteins L2, RNA binding domain 3.5E-12 21 99

GO

GO Term Description Terminal node
GO:0006412 translation Yes
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043043 peptide biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006518 peptide metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0005198 structural molecule activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0008150 biological_process No
GO:0019538 protein metabolic process No
GO:0044424 intracellular part No
GO:0009058 biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0044267 cellular protein metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0043604 amide biosynthetic process No
GO:1990904 ribonucleoprotein complex No
GO:0043603 cellular amide metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0032991 protein-containing complex No
GO:0008152 metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5585.t1
MLLFHFETVAMGRVIRNQRKGRGSIFTANTRLNKAPAQFRTLDFAEAHGYTRGVVKEIIHDAGRGAPLAKVQFRH
PYKFKMVTETFIANEGMYTGQFIYAGKNAALTVGNVLPLGSMPEGTVVSNVEEKAGDRGALGRTSGNYVTIIGHN
PEDGKTRVKLPSGAKKVIKNTARGMVGIVAGGGRTDKPLLKAGRAKHKFAVKRNSWPKTRGVAMNPVDHPHGGGN
HQHIGKASTISRYATQGQKAGLIAARRTGLLRGTQKTKD*
Coding >Pro_DTO377G3_2|g5585.t1
ATGCTCCTATTTCACTTCGAGACAGTCGCCATGGGTCGTGTCATCCGCAACCAGAGGAAGGGCCGTGGCTCCATT
TTCACGGCCAACACCCGCCTGAACAAGGCCCCTGCCCAATTCCGGACCCTCGACTTCGCTGAGGCTCACGGTTAC
ACCCGTGGTGTCGTCAAGGAGATCATCCACGATGCCGGTCGTGGTGCTCCCCTCGCCAAGGTCCAGTTCCGCCAC
CCCTACAAGTTCAAGATGGTCACCGAGACTTTCATCGCCAACGAGGGCATGTACACCGGCCAGTTCATCTACGCC
GGTAAGAACGCTGCCCTGACCGTCGGCAACGTCCTCCCTCTCGGCTCCATGCCCGAGGGTACCGTCGTCTCCAAC
GTCGAGGAGAAGGCTGGTGACCGTGGTGCGCTTGGCCGTACCTCCGGTAACTACGTTACCATTATTGGCCACAAC
CCCGAGGATGGCAAGACCCGTGTCAAGCTCCCCTCCGGTGCCAAGAAGGTCATCAAGAACACCGCCCGCGGTATG
GTTGGTATCGTTGCCGGTGGTGGCCGTACCGACAAGCCTTTGCTCAAGGCCGGTCGTGCCAAGCACAAGTTCGCC
GTCAAGCGCAACTCTTGGCCCAAGACTCGTGGTGTTGCCATGAACCCCGTCGATCACCCCCACGGTGGTGGTAAC
CACCAGCACATCGGTAAGGCCTCGACCATCTCCCGCTACGCTACCCAGGGTCAAAAGGCTGGTCTCATTGCCGCC
CGCAGAACTGGTCTGCTCCGCGGTACCCAGAAGACCAAGGATTAA
Transcript >Pro_DTO377G3_2|g5585.t1
ATGCTCCTATTTCACTTCGAGACAGTCGCCATGGGTCGTGTCATCCGCAACCAGAGGAAGGGCCGTGGCTCCATT
TTCACGGCCAACACCCGCCTGAACAAGGCCCCTGCCCAATTCCGGACCCTCGACTTCGCTGAGGCTCACGGTTAC
ACCCGTGGTGTCGTCAAGGAGATCATCCACGATGCCGGTCGTGGTGCTCCCCTCGCCAAGGTCCAGTTCCGCCAC
CCCTACAAGTTCAAGATGGTCACCGAGACTTTCATCGCCAACGAGGGCATGTACACCGGCCAGTTCATCTACGCC
GGTAAGAACGCTGCCCTGACCGTCGGCAACGTCCTCCCTCTCGGCTCCATGCCCGAGGGTACCGTCGTCTCCAAC
GTCGAGGAGAAGGCTGGTGACCGTGGTGCGCTTGGCCGTACCTCCGGTAACTACGTTACCATTATTGGCCACAAC
CCCGAGGATGGCAAGACCCGTGTCAAGCTCCCCTCCGGTGCCAAGAAGGTCATCAAGAACACCGCCCGCGGTATG
GTTGGTATCGTTGCCGGTGGTGGCCGTACCGACAAGCCTTTGCTCAAGGCCGGTCGTGCCAAGCACAAGTTCGCC
GTCAAGCGCAACTCTTGGCCCAAGACTCGTGGTGTTGCCATGAACCCCGTCGATCACCCCCACGGTGGTGGTAAC
CACCAGCACATCGGTAAGGCCTCGACCATCTCCCGCTACGCTACCCAGGGTCAAAAGGCTGGTCTCATTGCCGCC
CGCAGAACTGGTCTGCTCCGCGGTACCCAGAAGACCAAGGATTAA
Gene >Pro_DTO377G3_2|g5585.t1
ATGCTGTAGTTCAAGCCAATTCAAGTAAGCGACCATGCGCTATACCCGATTGGGTTAGATTAGCGACCGCACCCT
AAAGCCCACACAAGTCCCCGTGTCCGATGATTTCTCAACTCGTCAACGACAAGCCTATTTCACTTCGAGGTACGC
TTACCACTTTTCCACGACACTTCTGTCCGGCTTCCATACTAACATAGGATCCTCGTCTAGACAGTCGCCATGGGT
CGTGTCATCCGCAACCAGAGGAAGGGCCGTGGCTCCATTTTCAGTGAGTGCGACCGCAAACCATTCCCGCACGAA
ATTTTGAGGCTGCGCATCCCGAGCAGCGAGGAGGAAATGAAGAATACCATTGGAAGACCACACAGATTCGCAAGG
AGATTGGAGTGCTGATTACGAATTTTTCTCTACTTTACAGCGGCCAACACCCGCCTGAACAAGGCCCCTGCCCAA
TTCCGGACCCTCGACTTCGCTGAGGCTCACGGTTACACCCGTGGTGTCGTCAAGGAGATCATCCACGATGCCGGT
CGTGGTGCTCCCCTCGCCAAGGTCCAGTTCCGCCACCCCTACAAGTTCAAGATGGTCACCGAGACTTTCATCGCC
AACGAGGGCATGTACACCGGCCAGTTCATCTACGCCGGTAAGAACGCTGCCCTGACCGTCGGCAACGTCCTCCCT
CTCGGCTCCATGCCCGAGGGTACCGTCGTCTCCAACGTCGAGGAGAAGGCTGGTGACCGTGGTGCGCTTGGCCGT
ACCTCCGGTAACTACGTTACCATTATTGGCCACAACCCCGAGGATGGCAAGACCCGTGTCAAGCTCCCCTCCGGT
GCCAAGAAGGTCATCAAGAACACCGCCCGCGGTATGGTTGGTATCGTTGCCGGTGGTGGCCGTACCGACAAGCCT
TTGCTCAAGGCCGGTCGTGCCAAGCACAAGTTCGCCGTCAAGCGCAACTCTTGGCCCAAGACTCGTGGTGTTGCC
ATGAACCCCGTCGATCACGTAAGTTTCCGTCTATACACAGATCCGATAACATCCAGGACCGCAATCTCTAACATC
TCTCTCTACAGCCCCACGGTGGTGGTAACCACCAGCACATCGGTAAGGCCTCGACCATCTCCCGCTACGCTACCC
AGGGTCAAAAGGCTGGTCTCATTGCCGCCCGCAGAACTGGTCTGCTCCGCGGTACCCAGAAGACCAAGGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail