Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5567.t1
Gene name
Locationscaffold_13:452993..453743
Strand+
Gene length (bp)750
Transcript length (bp)750
Coding sequence length (bp)750
Protein length (aa) 250

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13419 HAD_2 Haloacid dehalogenase-like hydrolase 3.3E-20 22 215
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 2.9E-09 22 210
PF12710 HAD haloacid dehalogenase-like hydrolase 1.2E-07 22 209

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 8.19 2.23 14.15
5d_25C Five days - 25 degrees Celsius 6.22 1.34 11.10
7d_25C Seven days - 25 degrees Celsius 6.51 1.46 11.56
10d_25C Ten days - 25 degrees Celsius 4.84 0.96 8.71
7d_15C Seven days - 15 degrees Celsius 9.74 2.98 16.50
7d_30C Seven days - 30 degrees Celsius 10.45 3.21 17.70

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.605826 no
3d_25C 7d_25C 0.671003 no
3d_25C 7d_15C 0.741895 no
3d_25C 7d_30C 0.615942 no
3d_25C 10d_25C 0.245501 no
5d_25C 7d_25C 0.947197 no
5d_25C 7d_15C 0.318614 no
5d_25C 7d_30C 0.233992 no
5d_25C 10d_25C 0.653267 no
7d_25C 7d_15C 0.371081 no
7d_25C 7d_30C 0.281304 no
7d_25C 10d_25C 0.575801 no
7d_15C 7d_30C 0.903509 no
7d_15C 10d_25C 0.086230 no
7d_30C 10d_25C 0.056008 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5567.t1
MTTLKYPMSIQGIILSKFWFGFDLDDTLHEFRRASANASVRVFETIHASNNKTSVDTLKNTYQDILRNTTANAFT
DGRTSSEYRRERFGRLLQTHGLTDDSFLSRLLEVYRDSLRENLTLKPGGLHLLQTLRELGKKIIVITEGPADAQE
WTVQELGIRPYIDVLVTTNEVGKSKIDGLFGAVLEKYGIAAEDIVYFGDNAIRDVQAARQEGILAVLYDEKQQSR
FYDISALRVDSWAIVEKVLVHGDI*
Coding >Pro_DTO377G3_2|g5567.t1
ATGACCACTCTGAAATACCCCATGTCTATCCAAGGAATTATCCTCTCAAAATTCTGGTTCGGCTTCGATCTAGAT
GACACGCTCCACGAATTCCGACGGGCCTCTGCCAATGCCTCGGTCCGCGTCTTCGAAACGATTCACGCCTCAAAC
AACAAGACCAGCGTTGATACTCTCAAGAATACATACCAAGATATCCTGCGCAATACAACCGCAAACGCCTTCACA
GATGGGAGGACTTCAAGCGAGTATCGGCGCGAACGGTTCGGGCGTCTTCTCCAGACGCACGGGCTCACTGATGAC
TCTTTCCTGAGTCGTCTGTTAGAGGTATATCGAGACTCTCTACGCGAAAACTTGACTCTCAAGCCGGGTGGATTG
CATCTTTTGCAAACTTTGCGAGAACTGGGAAAGAAAATCATTGTCATTACTGAGGGTCCGGCGGATGCGCAGGAG
TGGACAGTCCAGGAACTCGGGATACGGCCTTACATTGATGTGCTTGTGACGACGAACGAGGTCGGGAAGTCTAAG
ATTGATGGGCTGTTTGGTGCCGTGCTGGAGAAATATGGTATCGCCGCTGAAGATATTGTATACTTCGGTGATAAT
GCGATTCGCGATGTTCAGGCTGCGCGGCAGGAAGGGATCCTGGCTGTTCTTTATGATGAAAAGCAGCAGTCTCGT
TTCTACGATATCAGTGCATTACGAGTGGATTCGTGGGCTATTGTAGAAAAAGTACTCGTCCATGGAGACATATAG
Transcript >Pro_DTO377G3_2|g5567.t1
ATGACCACTCTGAAATACCCCATGTCTATCCAAGGAATTATCCTCTCAAAATTCTGGTTCGGCTTCGATCTAGAT
GACACGCTCCACGAATTCCGACGGGCCTCTGCCAATGCCTCGGTCCGCGTCTTCGAAACGATTCACGCCTCAAAC
AACAAGACCAGCGTTGATACTCTCAAGAATACATACCAAGATATCCTGCGCAATACAACCGCAAACGCCTTCACA
GATGGGAGGACTTCAAGCGAGTATCGGCGCGAACGGTTCGGGCGTCTTCTCCAGACGCACGGGCTCACTGATGAC
TCTTTCCTGAGTCGTCTGTTAGAGGTATATCGAGACTCTCTACGCGAAAACTTGACTCTCAAGCCGGGTGGATTG
CATCTTTTGCAAACTTTGCGAGAACTGGGAAAGAAAATCATTGTCATTACTGAGGGTCCGGCGGATGCGCAGGAG
TGGACAGTCCAGGAACTCGGGATACGGCCTTACATTGATGTGCTTGTGACGACGAACGAGGTCGGGAAGTCTAAG
ATTGATGGGCTGTTTGGTGCCGTGCTGGAGAAATATGGTATCGCCGCTGAAGATATTGTATACTTCGGTGATAAT
GCGATTCGCGATGTTCAGGCTGCGCGGCAGGAAGGGATCCTGGCTGTTCTTTATGATGAAAAGCAGCAGTCTCGT
TTCTACGATATCAGTGCATTACGAGTGGATTCGTGGGCTATTGTAGAAAAAGTACTCGTCCATGGAGACATATAG
Gene >Pro_DTO377G3_2|g5567.t1
ATGACCACTCTGAAATACCCCATGTCTATCCAAGGAATTATCCTCTCAAAATTCTGGTTCGGCTTCGATCTAGAT
GACACGCTCCACGAATTCCGACGGGCCTCTGCCAATGCCTCGGTCCGCGTCTTCGAAACGATTCACGCCTCAAAC
AACAAGACCAGCGTTGATACTCTCAAGAATACATACCAAGATATCCTGCGCAATACAACCGCAAACGCCTTCACA
GATGGGAGGACTTCAAGCGAGTATCGGCGCGAACGGTTCGGGCGTCTTCTCCAGACGCACGGGCTCACTGATGAC
TCTTTCCTGAGTCGTCTGTTAGAGGTATATCGAGACTCTCTACGCGAAAACTTGACTCTCAAGCCGGGTGGATTG
CATCTTTTGCAAACTTTGCGAGAACTGGGAAAGAAAATCATTGTCATTACTGAGGGTCCGGCGGATGCGCAGGAG
TGGACAGTCCAGGAACTCGGGATACGGCCTTACATTGATGTGCTTGTGACGACGAACGAGGTCGGGAAGTCTAAG
ATTGATGGGCTGTTTGGTGCCGTGCTGGAGAAATATGGTATCGCCGCTGAAGATATTGTATACTTCGGTGATAAT
GCGATTCGCGATGTTCAGGCTGCGCGGCAGGAAGGGATCCTGGCTGTTCTTTATGATGAAAAGCAGCAGTCTCGT
TTCTACGATATCAGTGCATTACGAGTGGATTCGTGGGCTATTGTAGAAAAAGTACTCGTCCATGGAGACATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail