Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5550.t1
Gene name
Locationscaffold_13:416242..417840
Strand+
Gene length (bp)1598
Transcript length (bp)1545
Coding sequence length (bp)1545
Protein length (aa) 515

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain 1.1E-131 16 513
PF03199 GSH_synthase Eukaryotic glutathione synthase 1.8E-28 229 337

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006750 glutathione biosynthetic process Yes
GO:0004363 glutathione synthase activity Yes
GO:0006518 peptide metabolic process No
GO:0017076 purine nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0043043 peptide biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009987 cellular process No
GO:0044272 sulfur compound biosynthetic process No
GO:0043168 anion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0003824 catalytic activity No
GO:0051188 cofactor biosynthetic process No
GO:0032553 ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0019184 nonribosomal peptide biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0051186 cofactor metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0006790 sulfur compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0044237 cellular metabolic process No
GO:0005488 binding No
GO:0009058 biosynthetic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0042398 cellular modified amino acid biosynthetic process No
GO:0006749 glutathione metabolic process No
GO:0043167 ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:1901576 organic substance biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0008150 biological_process No
GO:0043603 cellular amide metabolic process No
GO:0016874 ligase activity No
GO:0008152 metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0016881 acid-amino acid ligase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5550.t1
MAESIYSNYPPDLSPAQQKFLVTSVKDWAIQNGLAVRPSPAIVPAGLDPNGVLATNAPVTLFPSPFPRTCFEEAT
ALQEIYNKLYATITCNEEWLGKIVEELIEVDDFVLNLWKVHQDVKKEGYVQDLSLGLFRSDYMAHVLPTGATALK
QVEFNTISSSFGGLSALVRKMHTELLSSPPGSSINYPPHPLLQSEVPPENTAVETLSAGLAAAHEAYGVSKSTPA
LPLCVLFIVQESERNVFDQHALSTQLKKVHNIPVFRVASVDILDQTSIPSSNSARPLLYQPPHSPDSTFEVTTVY
LRGYYAPDEYKSNRDWLARTHLERSAAIKCPSVLNQLSGCKKVQQVLAEPKGPDHLASFLKGVDTTLIERVRDTF
APQYDLSVDSQGRDLALNPDTAMNHVLKPQREGGGNNIYKSDIPTFLRSIPESDWRGWVLMELINPAANAQNVAL
RNDGEVLRGHVISELGIYGTILWESTGKILHNQQGGYLLRTKGKEVNEGGVAAGFSSLDSAILF*
Coding >Pro_DTO377G3_2|g5550.t1
ATGGCAGAATCAATTTATTCAAACTATCCGCCAGATCTGTCTCCAGCTCAACAAAAGTTTCTTGTCACATCTGTG
AAAGACTGGGCTATTCAAAATGGTCTCGCTGTTCGACCATCCCCAGCAATTGTCCCAGCTGGCCTAGATCCAAAT
GGGGTGCTGGCTACAAATGCACCGGTGACATTGTTTCCCAGTCCGTTTCCTCGGACTTGCTTCGAGGAAGCCACT
GCTCTCCAAGAGATCTACAACAAACTTTATGCTACGATCACATGCAATGAAGAATGGCTGGGAAAGATTGTGGAA
GAGCTCATTGAAGTTGATGACTTTGTTTTGAACTTGTGGAAGGTTCATCAGGATGTGAAGAAGGAAGGATATGTT
CAAGACCTGTCACTGGGCCTCTTCCGGTCCGATTACATGGCCCATGTTCTGCCTACAGGTGCCACGGCTCTAAAG
CAGGTTGAATTTAACACGATCTCGTCATCGTTTGGAGGGCTTTCAGCTCTTGTGCGAAAAATGCACACCGAGCTT
CTTTCCTCGCCGCCGGGTTCCTCAATCAACTATCCACCCCACCCTCTGCTACAATCCGAGGTTCCACCGGAGAAC
ACCGCAGTGGAAACCCTCTCAGCAGGTTTGGCGGCAGCCCACGAGGCCTACGGGGTGTCCAAGTCCACCCCGGCC
CTACCTCTTTGTGTTCTCTTTATAGTCCAGGAGTCAGAGCGGAACGTTTTTGATCAGCATGCACTCTCAACACAG
CTCAAGAAAGTTCACAACATCCCAGTCTTCCGTGTGGCTAGCGTCGATATCTTGGATCAGACATCCATTCCCAGC
TCCAACTCCGCACGACCATTGTTATACCAGCCTCCTCACTCACCCGACTCAACCTTCGAGGTAACAACTGTTTAT
CTTCGAGGTTACTATGCACCAGACGAGTACAAATCCAACCGTGACTGGCTGGCCCGAACTCACCTGGAGCGCTCG
GCGGCGATCAAGTGCCCTTCCGTGCTCAATCAGCTGTCTGGCTGCAAGAAAGTTCAGCAGGTCTTAGCAGAGCCG
AAAGGGCCAGATCATCTCGCAAGCTTCTTGAAGGGGGTTGACACTACGCTCATTGAAAGAGTTCGAGATACCTTT
GCTCCGCAATATGACCTGTCAGTTGACAGCCAGGGCCGCGATCTAGCCCTCAACCCAGATACCGCCATGAACCAT
GTGCTCAAACCACAGCGTGAAGGGGGTGGCAACAATATCTACAAATCCGATATTCCAACCTTTTTGCGATCTATT
CCGGAATCTGATTGGAGAGGCTGGGTACTTATGGAACTCATCAACCCTGCAGCCAATGCCCAAAATGTTGCTCTA
CGGAATGACGGCGAGGTCCTTCGAGGACATGTCATCTCTGAGCTTGGTATTTATGGTACCATTCTTTGGGAAAGT
ACTGGGAAGATTTTGCACAATCAACAAGGCGGGTATCTGTTGAGGACCAAGGGGAAGGAGGTGAATGAGGGTGGC
GTAGCCGCAGGATTCTCCAGCTTGGACAGTGCTATTTTGTTCTAG
Transcript >Pro_DTO377G3_2|g5550.t1
ATGGCAGAATCAATTTATTCAAACTATCCGCCAGATCTGTCTCCAGCTCAACAAAAGTTTCTTGTCACATCTGTG
AAAGACTGGGCTATTCAAAATGGTCTCGCTGTTCGACCATCCCCAGCAATTGTCCCAGCTGGCCTAGATCCAAAT
GGGGTGCTGGCTACAAATGCACCGGTGACATTGTTTCCCAGTCCGTTTCCTCGGACTTGCTTCGAGGAAGCCACT
GCTCTCCAAGAGATCTACAACAAACTTTATGCTACGATCACATGCAATGAAGAATGGCTGGGAAAGATTGTGGAA
GAGCTCATTGAAGTTGATGACTTTGTTTTGAACTTGTGGAAGGTTCATCAGGATGTGAAGAAGGAAGGATATGTT
CAAGACCTGTCACTGGGCCTCTTCCGGTCCGATTACATGGCCCATGTTCTGCCTACAGGTGCCACGGCTCTAAAG
CAGGTTGAATTTAACACGATCTCGTCATCGTTTGGAGGGCTTTCAGCTCTTGTGCGAAAAATGCACACCGAGCTT
CTTTCCTCGCCGCCGGGTTCCTCAATCAACTATCCACCCCACCCTCTGCTACAATCCGAGGTTCCACCGGAGAAC
ACCGCAGTGGAAACCCTCTCAGCAGGTTTGGCGGCAGCCCACGAGGCCTACGGGGTGTCCAAGTCCACCCCGGCC
CTACCTCTTTGTGTTCTCTTTATAGTCCAGGAGTCAGAGCGGAACGTTTTTGATCAGCATGCACTCTCAACACAG
CTCAAGAAAGTTCACAACATCCCAGTCTTCCGTGTGGCTAGCGTCGATATCTTGGATCAGACATCCATTCCCAGC
TCCAACTCCGCACGACCATTGTTATACCAGCCTCCTCACTCACCCGACTCAACCTTCGAGGTAACAACTGTTTAT
CTTCGAGGTTACTATGCACCAGACGAGTACAAATCCAACCGTGACTGGCTGGCCCGAACTCACCTGGAGCGCTCG
GCGGCGATCAAGTGCCCTTCCGTGCTCAATCAGCTGTCTGGCTGCAAGAAAGTTCAGCAGGTCTTAGCAGAGCCG
AAAGGGCCAGATCATCTCGCAAGCTTCTTGAAGGGGGTTGACACTACGCTCATTGAAAGAGTTCGAGATACCTTT
GCTCCGCAATATGACCTGTCAGTTGACAGCCAGGGCCGCGATCTAGCCCTCAACCCAGATACCGCCATGAACCAT
GTGCTCAAACCACAGCGTGAAGGGGGTGGCAACAATATCTACAAATCCGATATTCCAACCTTTTTGCGATCTATT
CCGGAATCTGATTGGAGAGGCTGGGTACTTATGGAACTCATCAACCCTGCAGCCAATGCCCAAAATGTTGCTCTA
CGGAATGACGGCGAGGTCCTTCGAGGACATGTCATCTCTGAGCTTGGTATTTATGGTACCATTCTTTGGGAAAGT
ACTGGGAAGATTTTGCACAATCAACAAGGCGGGTATCTGTTGAGGACCAAGGGGAAGGAGGTGAATGAGGGTGGC
GTAGCCGCAGGATTCTCCAGCTTGGACAGTGCTATTTTGTTCTAG
Gene >Pro_DTO377G3_2|g5550.t1
ATGGCAGAATCAATTTATTCAAACTATCCGCCAGATCTGTCTCCAGCTCAACAAAAGTTTCTTGTCACATCTGTG
AAAGACTGGGCTATTCAAAATGGTCTCGCTGTTCGACCATCCCCAGCAATTGTCCCAGCTGGCCTAGATCCAAAT
GGGGTGCTGGCTACAAATGCACCGGTGACATTGTTTCCCAGTCCGTTTCCTCGGACTTGCTTCGAGGAAGCCACT
GCTCTCCAAGAGATCTACAACAAACTTTATGCTACGATCACATGCAATGAAGAATGGCTGGGAAAGATTGTGGAA
GAGTAAGGATATTTCTGCTCTAGTATGGTAGATGTTCATTATTGACCATTTTCAGGCTCATTGAAGTTGATGACT
TTGTTTTGAACTTGTGGAAGGTTCATCAGGATGTGAAGAAGGAAGGATATGTTCAAGACCTGTCACTGGGCCTCT
TCCGGTCCGATTACATGGCCCATGTTCTGCCTACAGGTGCCACGGCTCTAAAGCAGGTTGAATTTAACACGATCT
CGTCATCGTTTGGAGGGCTTTCAGCTCTTGTGCGAAAAATGCACACCGAGCTTCTTTCCTCGCCGCCGGGTTCCT
CAATCAACTATCCACCCCACCCTCTGCTACAATCCGAGGTTCCACCGGAGAACACCGCAGTGGAAACCCTCTCAG
CAGGTTTGGCGGCAGCCCACGAGGCCTACGGGGTGTCCAAGTCCACCCCGGCCCTACCTCTTTGTGTTCTCTTTA
TAGTCCAGGAGTCAGAGCGGAACGTTTTTGATCAGCATGCACTCTCAACACAGCTCAAGAAAGTTCACAACATCC
CAGTCTTCCGTGTGGCTAGCGTCGATATCTTGGATCAGACATCCATTCCCAGCTCCAACTCCGCACGACCATTGT
TATACCAGCCTCCTCACTCACCCGACTCAACCTTCGAGGTAACAACTGTTTATCTTCGAGGTTACTATGCACCAG
ACGAGTACAAATCCAACCGTGACTGGCTGGCCCGAACTCACCTGGAGCGCTCGGCGGCGATCAAGTGCCCTTCCG
TGCTCAATCAGCTGTCTGGCTGCAAGAAAGTTCAGCAGGTCTTAGCAGAGCCGAAAGGGCCAGATCATCTCGCAA
GCTTCTTGAAGGGGGTTGACACTACGCTCATTGAAAGAGTTCGAGATACCTTTGCTCCGCAATATGACCTGTCAG
TTGACAGCCAGGGCCGCGATCTAGCCCTCAACCCAGATACCGCCATGAACCATGTGCTCAAACCACAGCGTGAAG
GGGGTGGCAACAATATCTACAAATCCGATATTCCAACCTTTTTGCGATCTATTCCGGAATCTGATTGGAGAGGCT
GGGTACTTATGGAACTCATCAACCCTGCAGCCAATGCCCAAAATGTTGCTCTACGGAATGACGGCGAGGTCCTTC
GAGGACATGTCATCTCTGAGCTTGGTATTTATGGTACCATTCTTTGGGAAAGTACTGGGAAGATTTTGCACAATC
AACAAGGCGGGTATCTGTTGAGGACCAAGGGGAAGGAGGTGAATGAGGGTGGCGTAGCCGCAGGATTCTCCAGCT
TGGACAGTGCTATTTTGTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail