Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g555.t1
Gene name
Locationscaffold_01:1431830..1433289
Strand-
Gene length (bp)1459
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02434 Fringe Fringe-like 8.6E-05 192 291

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016020 membrane Yes
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g555.t1
MPSLPPRYGRWVLILGPVVLILLILQFIHADFGSKTTQDVVGSVSGLTIDTYNETDSKTETHHVPSSCPTDTGMD
SVLVVVKTGITEAQNKVPVHLRTTLRCVPHKIIVSDFEEDIAGTRTHDVFLNVSDTLKQSNQDFAIYNRARTGGH
TALTSQDHTKVANGPAGMMDNPGWKLDKWKFLPMIHTALRAKPDAKWFVFLEADTYPIWPNLLAWLAHFNPEDKL
YLGNQMQIGSTLFAHGGSGFVLSHAAIHTVADFHKMSVDAWDAITNQEWAGDCVLGRALAAAGIRLTWSWPHVTT
QSVWEQDMLHEAYAKIPWCFAPFTFHHMTPADVDRFWEFEQQWFATSNSSVLTYSDIFRNLIRPTLADHLDNWDN
FASKGDDKEDYKGPKTPTSFASCADYCAADPECIQYRLTADSRCTTSNAVLRGKPQPGTQSGTMLWRVDAALERM
EQCENVAWVTS*
Coding >Pro_DTO377G3_2|g555.t1
ATGCCTTCTCTCCCGCCCCGATATGGTCGCTGGGTACTTATCCTGGGCCCGGTGGTTCTCATCCTCTTGATACTC
CAATTTATCCACGCCGATTTCGGCTCAAAGACCACGCAGGACGTGGTCGGATCCGTCTCCGGGCTAACGATTGAT
ACATACAACGAGACCGACTCAAAAACTGAAACCCACCATGTACCATCATCCTGCCCGACAGACACGGGAATGGAC
TCAGTGCTGGTAGTGGTAAAAACGGGCATCACGGAAGCGCAAAACAAAGTCCCTGTACACTTAAGAACGACTCTC
CGCTGCGTGCCGCACAAGATAATCGTCTCAGACTTCGAAGAAGACATAGCCGGTACACGCACCCACGACGTCTTC
CTCAACGTCTCCGACACCCTCAAACAAAGCAACCAAGACTTCGCTATATACAACCGCGCCCGCACAGGCGGACAC
ACAGCCCTAACCTCCCAAGACCATACGAAAGTCGCCAACGGCCCAGCTGGGATGATGGACAACCCAGGCTGGAAG
CTGGATAAGTGGAAATTCCTCCCGATGATCCACACCGCGCTGCGCGCGAAGCCAGACGCCAAGTGGTTCGTCTTC
CTCGAAGCAGACACGTACCCGATCTGGCCGAACCTGCTCGCGTGGCTGGCGCATTTCAACCCCGAAGACAAGCTG
TATCTGGGGAATCAGATGCAGATTGGGTCGACTTTGTTTGCGCATGGTGGGTCGGGGTTTGTGCTGTCTCATGCG
GCTATTCATACCGTGGCGGATTTCCATAAAATGAGTGTTGATGCGTGGGATGCGATCACGAACCAGGAATGGGCG
GGCGATTGTGTGCTTGGGAGGGCGCTTGCTGCTGCGGGTATTAGGCTTACTTGGTCTTGGCCGCATGTGACTACT
CAGTCGGTTTGGGAGCAGGATATGTTGCATGAGGCTTATGCGAAGATACCTTGGTGTTTTGCGCCTTTTACTTTC
CACCATATGACGCCGGCGGATGTGGATCGGTTTTGGGAATTCGAGCAGCAGTGGTTTGCGACTTCAAACTCAAGC
GTTCTTACATACAGCGACATCTTCCGCAACCTCATCCGCCCAACCCTCGCAGACCACCTAGACAACTGGGATAAC
TTTGCGAGCAAAGGCGACGACAAAGAAGATTACAAGGGACCCAAGACGCCGACTTCTTTCGCTTCCTGTGCGGAC
TACTGCGCTGCAGATCCAGAATGCATCCAGTACCGCCTGACAGCTGACTCGCGCTGCACAACGTCCAATGCGGTG
CTGCGTGGGAAGCCCCAGCCAGGCACGCAGTCAGGGACGATGCTATGGCGGGTTGATGCTGCGTTGGAGCGGATG
GAGCAGTGTGAGAATGTGGCGTGGGTGACCAGCTAG
Transcript >Pro_DTO377G3_2|g555.t1
ATGCCTTCTCTCCCGCCCCGATATGGTCGCTGGGTACTTATCCTGGGCCCGGTGGTTCTCATCCTCTTGATACTC
CAATTTATCCACGCCGATTTCGGCTCAAAGACCACGCAGGACGTGGTCGGATCCGTCTCCGGGCTAACGATTGAT
ACATACAACGAGACCGACTCAAAAACTGAAACCCACCATGTACCATCATCCTGCCCGACAGACACGGGAATGGAC
TCAGTGCTGGTAGTGGTAAAAACGGGCATCACGGAAGCGCAAAACAAAGTCCCTGTACACTTAAGAACGACTCTC
CGCTGCGTGCCGCACAAGATAATCGTCTCAGACTTCGAAGAAGACATAGCCGGTACACGCACCCACGACGTCTTC
CTCAACGTCTCCGACACCCTCAAACAAAGCAACCAAGACTTCGCTATATACAACCGCGCCCGCACAGGCGGACAC
ACAGCCCTAACCTCCCAAGACCATACGAAAGTCGCCAACGGCCCAGCTGGGATGATGGACAACCCAGGCTGGAAG
CTGGATAAGTGGAAATTCCTCCCGATGATCCACACCGCGCTGCGCGCGAAGCCAGACGCCAAGTGGTTCGTCTTC
CTCGAAGCAGACACGTACCCGATCTGGCCGAACCTGCTCGCGTGGCTGGCGCATTTCAACCCCGAAGACAAGCTG
TATCTGGGGAATCAGATGCAGATTGGGTCGACTTTGTTTGCGCATGGTGGGTCGGGGTTTGTGCTGTCTCATGCG
GCTATTCATACCGTGGCGGATTTCCATAAAATGAGTGTTGATGCGTGGGATGCGATCACGAACCAGGAATGGGCG
GGCGATTGTGTGCTTGGGAGGGCGCTTGCTGCTGCGGGTATTAGGCTTACTTGGTCTTGGCCGCATGTGACTACT
CAGTCGGTTTGGGAGCAGGATATGTTGCATGAGGCTTATGCGAAGATACCTTGGTGTTTTGCGCCTTTTACTTTC
CACCATATGACGCCGGCGGATGTGGATCGGTTTTGGGAATTCGAGCAGCAGTGGTTTGCGACTTCAAACTCAAGC
GTTCTTACATACAGCGACATCTTCCGCAACCTCATCCGCCCAACCCTCGCAGACCACCTAGACAACTGGGATAAC
TTTGCGAGCAAAGGCGACGACAAAGAAGATTACAAGGGACCCAAGACGCCGACTTCTTTCGCTTCCTGTGCGGAC
TACTGCGCTGCAGATCCAGAATGCATCCAGTACCGCCTGACAGCTGACTCGCGCTGCACAACGTCCAATGCGGTG
CTGCGTGGGAAGCCCCAGCCAGGCACGCAGTCAGGGACGATGCTATGGCGGGTTGATGCTGCGTTGGAGCGGATG
GAGCAGTGTGAGAATGTGGCGTGGGTGACCAGCTAG
Gene >Pro_DTO377G3_2|g555.t1
ATGCCTTCTCTCCCGCCCCGATATGGTCGCTGGGTACTTATCCTGGGCCCGGTGGTTCTCATCCTCTTGATACTC
CAATTTATCCACGCCGATTTCGGCTCAAAGACCACGCAGGACGTGGTCGGATCCGTCTCCGGGCTAACGATTGAT
ACATACAACGAGACCGACTCAAAAACTGAAACCCACCATGTACCATCATCCTGCCCGACAGACACGGGAATGGAC
TCAGTGCTGGTAGTGGTAAAAACGGGCATCACGGAAGCGCAAAACAAAGTCCCTGTACACTTAAGAACGACTCTC
CGCTGCGTGCCGCACAAGATAATCGTCTCAGACTTCGAAGAAGACATAGCCGGTACACGCACCCACGACGTCTTC
CTCAACGTCTCCGACACCCTCAAACAAAGCAACCAAGACTTCGCTATATACAACCGCGCCCGCACAGGCGGACAC
ACAGCCCTAACCTCCCAAGACCATACGAAAGTCGCCAACGGCCCAGCTGGGATGATGGACAACCCAGGCTGGAAG
CTGGATAAGTGGAAATTCCTCCCGATGATCCACACCGCGCTGCGCGCGAAGCCAGACGCCAAGTGGTTCGTCTTC
CTCGAAGCAGACACGTACCCGATCTGGCCGAACCTGCTCGCGTGGCTGGCGCATTTCAACCCCGAAGACAAGCTG
TATCTGGGGAATCAGATGCAGATTGGGTCGACTTTGTTTGCGCATGGTGGGTCGGGGTTTGTGCTGTCTCATGCG
GCTATTCATACCGTGGCGGATTTCCATAAAATGAGTGTTGATGCGTGGGATGCGATCACGAACCAGGAATGGGCG
GGCGATTGTGTGCTTGGGAGGGCGCTTGCTGCTGCGGGTATTAGGCTTACTTGGTCTTGGCCGCATGTGACTACT
CAGTCGGTTTGGGAGCAGGATATGTTGCATGAGGCTTATGCGAAGATACCTTGGTGTTTTGCGCCTTTTACTTTC
CACCATATGACGCCGGCGGATGTGGATCGGTTTTGGGAATTCGAGCAGCAGTGGTTTGCGACTGTGAGTTGCTTT
CTTTTCCCTTTTTTGGCGGTATATCCATCTCCCTGGAATATGTTACTGACAAAAAGCCCAGTCAAACTCAAGCGT
TCTTACATACAGCGACATCTTCCGCAACCTCATCCGCCCAACCCTCGCAGACCACCTAGACAACTGGGATAACTT
TGCGAGCAAAGGCGACGACAAAGAAGATTACAAGGGACCCAAGACGCCGACTTCTTTCGCTTCCTGTGCGGACTA
CTGCGCTGCAGATCCAGAATGCATCCAGTACCGCCTGACAGCTGACTCGCGCTGCACAACGTCCAATGCGGTGCT
GCGTGGGAAGCCCCAGCCAGGCACGCAGTCAGGGACGATGCTATGGCGGGTTGATGCTGCGTTGGAGCGGATGGA
GCAGTGTGAGAATGTGGCGTGGGTGACCAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail