Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5541.t1
Gene name
Locationscaffold_13:389303..390955
Strand+
Gene length (bp)1652
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16131 Torus Torus domain 5.9E-39 56 161
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.0E-07 200 248

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 68.93 41.41 96.46
5d_25C Five days - 25 degrees Celsius 75.87 45.97 105.76
7d_25C Seven days - 25 degrees Celsius 76.35 46.32 106.38
10d_25C Ten days - 25 degrees Celsius 88.51 53.92 123.10
7d_15C Seven days - 15 degrees Celsius 67.29 40.21 94.38
7d_30C Seven days - 30 degrees Celsius 64.43 38.41 90.45

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.744380 no
3d_25C 7d_25C 0.723859 no
3d_25C 7d_15C 0.944740 no
3d_25C 7d_30C 0.830856 no
3d_25C 10d_25C 0.300764 no
5d_25C 7d_25C 0.985937 no
5d_25C 7d_15C 0.670644 no
5d_25C 7d_30C 0.533374 no
5d_25C 10d_25C 0.559367 no
7d_25C 7d_15C 0.649850 no
7d_25C 7d_30C 0.512545 no
7d_25C 10d_25C 0.578667 no
7d_15C 7d_30C 0.896739 no
7d_15C 10d_25C 0.241986 no
7d_30C 10d_25C 0.157056 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5541.t1
MADTSVAEPPAPISTTPETLEVNAEQTIVATTGADETVQGEQQLQSVKKTKIIRRKKRPARIQVDASTIKAEPAQ
QPGLDYNIWYNKSGDNDDKYGLSQPAPSRCNIARDSGYTRADRIPGSFFCIHFARGVCVKGQDCEYLHRLPTIHD
MFNPNMDCFGRDKHSDYKEDMSGVGSFTRQNRTIYVGRITVSDDIEEVCSRHFAEWGQIERTRVLTGRGVAFVTY
SSESNAQFALAAMQNQSLDHEEILNVRWATVDPNPMAQKREARRLEEQAAEAVRRALPAAFVAEIEGRDPEAKRR
KKIEGTFGLQGYDVPDDVWHARTRQLEDASRAAQLEAPQQPMMIESASVSVQEQEQQPQSNGIFSSSALAALRGL
NGGTVTTQAPKAVGGPLVGYGSDDESD*
Coding >Pro_DTO377G3_2|g5541.t1
ATGGCAGATACATCGGTTGCTGAGCCACCAGCTCCCATTTCCACCACCCCCGAAACCCTTGAAGTCAATGCCGAA
CAGACAATTGTGGCAACAACCGGCGCGGACGAGACTGTGCAAGGAGAGCAGCAGCTTCAGTCGGTCAAGAAGACC
AAGATTATTCGCAGGAAGAAACGCCCAGCGAGGATACAAGTCGACGCGTCAACCATCAAAGCTGAGCCTGCACAG
CAGCCGGGACTCGACTATAATATTTGGTACAACAAGAGCGGCGACAACGACGACAAATATGGCCTCAGCCAGCCT
GCGCCTAGTCGCTGCAATATTGCGCGTGACTCGGGATACACTCGCGCTGATCGCATTCCGGGCTCCTTTTTCTGC
ATACATTTTGCGCGAGGCGTCTGCGTGAAAGGTCAGGACTGTGAATACCTCCATCGTCTACCGACGATTCACGAT
ATGTTCAATCCAAACATGGACTGCTTTGGGAGAGACAAGCACAGCGATTACAAGGAAGATATGTCCGGAGTAGGC
TCGTTCACACGCCAAAATAGGACAATCTACGTGGGTCGGATTACGGTTTCCGATGATATCGAGGAAGTGTGCTCA
AGGCATTTTGCGGAATGGGGTCAAATTGAAAGAACCAGAGTACTTACCGGACGGGGCGTGGCTTTCGTGACCTAT
TCGTCAGAAAGTAATGCGCAGTTTGCTCTAGCTGCGATGCAAAACCAAAGCTTGGATCATGAAGAAATTCTTAAC
GTACGATGGGCAACGGTCGACCCGAACCCAATGGCACAGAAGCGCGAGGCACGCCGGTTAGAAGAGCAAGCCGCC
GAGGCTGTGCGCCGGGCACTACCCGCAGCTTTTGTAGCAGAGATCGAAGGCCGAGATCCCGAAGCCAAGAGGCGG
AAGAAGATCGAGGGAACTTTTGGACTACAGGGCTATGACGTTCCAGATGATGTGTGGCATGCTAGAACCCGTCAA
TTGGAGGATGCGAGCCGGGCCGCTCAGCTAGAGGCACCCCAACAACCGATGATGATCGAGTCTGCTTCGGTTTCG
GTACAGGAGCAGGAGCAGCAGCCTCAGAGTAATGGCATCTTCTCCAGCTCAGCTCTCGCAGCCCTACGGGGTCTT
AATGGCGGAACGGTGACGACCCAGGCACCCAAGGCTGTTGGTGGACCGTTAGTCGGCTACGGCAGCGACGATGAG
AGTGACTGA
Transcript >Pro_DTO377G3_2|g5541.t1
ATGGCAGATACATCGGTTGCTGAGCCACCAGCTCCCATTTCCACCACCCCCGAAACCCTTGAAGTCAATGCCGAA
CAGACAATTGTGGCAACAACCGGCGCGGACGAGACTGTGCAAGGAGAGCAGCAGCTTCAGTCGGTCAAGAAGACC
AAGATTATTCGCAGGAAGAAACGCCCAGCGAGGATACAAGTCGACGCGTCAACCATCAAAGCTGAGCCTGCACAG
CAGCCGGGACTCGACTATAATATTTGGTACAACAAGAGCGGCGACAACGACGACAAATATGGCCTCAGCCAGCCT
GCGCCTAGTCGCTGCAATATTGCGCGTGACTCGGGATACACTCGCGCTGATCGCATTCCGGGCTCCTTTTTCTGC
ATACATTTTGCGCGAGGCGTCTGCGTGAAAGGTCAGGACTGTGAATACCTCCATCGTCTACCGACGATTCACGAT
ATGTTCAATCCAAACATGGACTGCTTTGGGAGAGACAAGCACAGCGATTACAAGGAAGATATGTCCGGAGTAGGC
TCGTTCACACGCCAAAATAGGACAATCTACGTGGGTCGGATTACGGTTTCCGATGATATCGAGGAAGTGTGCTCA
AGGCATTTTGCGGAATGGGGTCAAATTGAAAGAACCAGAGTACTTACCGGACGGGGCGTGGCTTTCGTGACCTAT
TCGTCAGAAAGTAATGCGCAGTTTGCTCTAGCTGCGATGCAAAACCAAAGCTTGGATCATGAAGAAATTCTTAAC
GTACGATGGGCAACGGTCGACCCGAACCCAATGGCACAGAAGCGCGAGGCACGCCGGTTAGAAGAGCAAGCCGCC
GAGGCTGTGCGCCGGGCACTACCCGCAGCTTTTGTAGCAGAGATCGAAGGCCGAGATCCCGAAGCCAAGAGGCGG
AAGAAGATCGAGGGAACTTTTGGACTACAGGGCTATGACGTTCCAGATGATGTGTGGCATGCTAGAACCCGTCAA
TTGGAGGATGCGAGCCGGGCCGCTCAGCTAGAGGCACCCCAACAACCGATGATGATCGAGTCTGCTTCGGTTTCG
GTACAGGAGCAGGAGCAGCAGCCTCAGAGTAATGGCATCTTCTCCAGCTCAGCTCTCGCAGCCCTACGGGGTCTT
AATGGCGGAACGGTGACGACCCAGGCACCCAAGGCTGTTGGTGGACCGTTAGTCGGCTACGGCAGCGACGATGAG
AGTGACTGA
Gene >Pro_DTO377G3_2|g5541.t1
ATGGCAGATACATCGGTTGCTGAGCCACCAGCTCCCATTTCCACCACCCCCGAAACCCTTGAAGTCAATGCCGAA
CAGACAATTGTGGCAACAACCGGCGCGGACGAGACTGTGCAAGGAGAGCAGCAGCTTCAGTCGGTCAAGAAGACC
AAGATTATTCGCAGGAAGAAACGCCCAGCGAGGATACAAGTCGACGCGTCAACCATCAAAGCTGAGCCTGCACAG
CAGCCGGGACTCGACTATAATATTTGGTACAACAAGAGCGGCGACAACGACGACAAATATGGCCTCAGCCAGCCT
GCGCCTAGTCGCTGCAATATTGCGCGTGACTCGGGATACACTCGCGCTGATCGCATTCCGGGCTCCTTTTTCTGG
TAGGAAATTTTACCATTGCGCATCGCGGTAGACATTTGCTAATCCTTTTTCCGTCCTATCTAGCATACATTTTGC
GCGAGGCGTCTGCGTGAAAGGTCAGGACTGTGAATACCTCCATCGTCTACCGACGATTCACGATATGTTAGTGAT
TCCCATGCCGTACGCGATTCGAGGATTCTTCTACTCTGTTGGACTCGTCGGATACAAAAGAACCTGGCTAATCAA
TGATTCTTAGGTTCAATCCAAACATGGACTGCTTTGGTTAGTCTCCTTGCTATTTGATTTTAAAACAGGCGACTG
ACTCCAGACTATAGGGAGAGACAAGCACAGCGATTACAAGGAAGTGAGTATCTCTTTGTGACTAGGAGATGTTGC
TTCGCTATGAACATATCGCTAACGCTACTTGAAATAGGATATGTCCGGAGTAGGCTCGTTCACACGCCAAAATAG
GACAATCTACGTGGGTCGGATTACGGTTTCGTGAGTACCTCGAAAGGCTATACTTCGTATTGTTGCTAATCAACA
TCTAGCGATGATATCGAGGAAGTGTGCTCAAGGCATTTTGCGGAATGGGGTCAAATTGAAAGAACCAGAGTACTT
ACCGGACGGGGCGTGGCTTTCGTGACCTATTCGTCAGAAAGTAATGCGCAGTTTGCGTAAGATACCCCTTCCCAA
GCTCTCTATTTGTACCGAACTAACATATGACTAAAGTCTAGCTGCGATGCAAAACCAAAGCTTGGATCATGAAGT
GAGTTCAACATTTCAATCCACAAGATGTGTTATACAAAGGTACTAACAACAAGTAGGAAATTCTTAACGTACGAT
GGGCAACGGTCGACCCGAACCCAATGGCACAGAAGCGCGAGGCACGCCGGTTAGAAGAGCAAGCCGCCGAGGCTG
TGCGCCGGGCACTACCCGCAGCTTTTGTAGCAGAGATCGAAGGCCGAGATCCCGAAGCCAAGAGGCGGAAGAAGA
TCGAGGGAACTTTTGGACTACAGGGCTATGACGTTCCAGATGATGTGTGGCATGCTAGAACCCGTCAATTGGAGG
ATGCGAGCCGGGCCGCTCAGCTAGAGGCACCCCAACAACCGATGATGATCGAGTCTGCTTCGGTTTCGGTACAGG
AGCAGGAGCAGCAGCCTCAGAGTAATGGCATCTTCTCCAGCTCAGCTCTCGCAGCCCTACGGGGTCTTAATGGCG
GAACGGTGACGACCCAGGCACCCAAGGCTGTTGGTGGACCGTTAGTCGGCTACGGCAGCGACGATGAGAGTGACT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail