Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5532.t1
Gene name
Locationscaffold_13:369166..369778
Strand+
Gene length (bp)612
Transcript length (bp)525
Coding sequence length (bp)525
Protein length (aa) 175

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01161 PBP Phosphatidylethanolamine-binding protein 1.3E-16 37 139

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Orthologs

Orthofinder run ID2
Orthogroup9835
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g6180.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g3204.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g1395.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g5014.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g3043.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g6109.t1
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g2772.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g2947.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g6703.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g835.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g3486.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g3284.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g9671.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g4779.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g5067.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g2298.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g5532.t1 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5532.t1
MPSDNHIKAALSLIEDKSKILGLTIGNYENVQPGTYLPRKACQEPPKLSFTGTNPNSTYMIVSMDIDAPFPGFGV
LGPILHWIQSDVKATSEGVLEYEAPFVANYIGPAPPPMSSPHRYTFFLYEQPADFDLTAHAPAGGKKLGNYNRMW
YDLDAWAEKIKLGPLVAFNYFTSN*
Coding >Pro_DTO377G3_2|g5532.t1
ATGCCTTCGGATAACCACATCAAAGCAGCCTTGTCTCTCATCGAGGACAAGTCCAAGATCCTTGGCTTGACCATC
GGCAACTATGAGAACGTGCAACCTGGAACATACCTACCCCGCAAAGCATGTCAAGAGCCCCCGAAGCTCTCCTTC
ACTGGCACCAACCCTAACAGCACCTACATGATCGTGAGCATGGACATCGATGCCCCCTTCCCTGGCTTCGGAGTC
CTGGGTCCCATACTTCACTGGATCCAGTCCGATGTCAAAGCCACCAGCGAGGGTGTGCTGGAGTACGAAGCGCCC
TTCGTCGCCAACTACATCGGCCCTGCTCCCCCTCCAATGAGCTCGCCCCATCGGTACACCTTCTTCCTGTACGAA
CAGCCTGCAGACTTTGATCTCACGGCCCATGCACCTGCTGGTGGTAAGAAGCTTGGCAACTACAATCGTATGTGG
TACGATCTTGATGCTTGGGCAGAGAAGATCAAGCTTGGTCCTCTTGTGGCTTTCAACTATTTTACCAGCAACTAG
Transcript >Pro_DTO377G3_2|g5532.t1
ATGCCTTCGGATAACCACATCAAAGCAGCCTTGTCTCTCATCGAGGACAAGTCCAAGATCCTTGGCTTGACCATC
GGCAACTATGAGAACGTGCAACCTGGAACATACCTACCCCGCAAAGCATGTCAAGAGCCCCCGAAGCTCTCCTTC
ACTGGCACCAACCCTAACAGCACCTACATGATCGTGAGCATGGACATCGATGCCCCCTTCCCTGGCTTCGGAGTC
CTGGGTCCCATACTTCACTGGATCCAGTCCGATGTCAAAGCCACCAGCGAGGGTGTGCTGGAGTACGAAGCGCCC
TTCGTCGCCAACTACATCGGCCCTGCTCCCCCTCCAATGAGCTCGCCCCATCGGTACACCTTCTTCCTGTACGAA
CAGCCTGCAGACTTTGATCTCACGGCCCATGCACCTGCTGGTGGTAAGAAGCTTGGCAACTACAATCGTATGTGG
TACGATCTTGATGCTTGGGCAGAGAAGATCAAGCTTGGTCCTCTTGTGGCTTTCAACTATTTTACCAGCAACTAG
Gene >Pro_DTO377G3_2|g5532.t1
ATGCCTTCGGATAACCACATCAAAGCAGCCTTGTCTCTCATCGAGGACAAGTCCAAGATCCTTGGCTTGACCATC
GGCAACTATGAGAACGTGCAACCTGGAACATACCTACCCCGCAAAGGTACGAAGCAGTCTATTGCCTGACCTCCC
CTTCCCCCCCCAAATCGTGTGACAGGCAATCCAAATATGGGACTAACAAAAACCACAGCATGTCAAGAGCCCCCG
AAGCTCTCCTTCACTGGCACCAACCCTAACAGCACCTACATGATCGTGAGCATGGACATCGATGCCCCCTTCCCT
GGCTTCGGAGTCCTGGGTCCCATACTTCACTGGATCCAGTCCGATGTCAAAGCCACCAGCGAGGGTGTGCTGGAG
TACGAAGCGCCCTTCGTCGCCAACTACATCGGCCCTGCTCCCCCTCCAATGAGCTCGCCCCATCGGTACACCTTC
TTCCTGTACGAACAGCCTGCAGACTTTGATCTCACGGCCCATGCACCTGCTGGTGGTAAGAAGCTTGGCAACTAC
AATCGTATGTGGTACGATCTTGATGCTTGGGCAGAGAAGATCAAGCTTGGTCCTCTTGTGGCTTTCAACTATTTT
ACCAGCAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail