Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5528.t1
Gene name
Locationscaffold_13:358525..360622
Strand+
Gene length (bp)2097
Transcript length (bp)1929
Coding sequence length (bp)1929
Protein length (aa) 643

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00258 Flavodoxin_1 Flavodoxin 4.2E-31 16 153
PF00667 FAD_binding_1 FAD binding domain 6.6E-30 229 450
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 6.4E-15 482 600

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0010181 FMN binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0050662 coenzyme binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5528.t1
MGDTQSLRPLERSVLILYGSETGNAQEVAEELGALTERLRFATHVSELNQCKPESLFSYTLTIFVASTTGQGDLP
ANARSFWKSLLLKKLPATFLNGINFTCFGLGDSSYPKFNWAIRKLYKRLLQLGANEIYPTGEADQQHPEGLEGTF
LPWMTDFRKHLLDRHPLPDGQHPIPDDVQLPPKWKLQLAVENDSAPIPQAAVANEHQASTDEYPGLYHLDHDSRP
IPHTLCATLTENRRATPQKHWQDVRHITLTVPGLVSYVPGDMIAITPKSSSIDVQTLIDLMGWNDQADRPISLVP
MGDIPSPPPIPGLDSYPNLTLRALLVDYLDVKGIPRRSFFSTIAHYTNDEMHKERLLEFTNPEYLDELWDYTTRP
RRSILEILHEFDSVKIPWQHAISVIPAMRARQFSIASGGKRKQTADGNTQFELLIAIVKYQTVIKRIREGVCTKY
LSVLRPGSTLQVQLQPGGLKSSVQQLTAATVLIGPGTGIAPLRSILWEKAALVQAYREQNPDVNPPIGPTILLYG
GRNRESDFFFEEEWTELSKLIPLQVITAFSRDQQRKVYVQDTIRENFALFFCVLHDMQGSVYICGSSGRMPQAVR
EALIETFQNGGAPLPGQPFTRSQAEGYLISMEQTGRYKQETW*
Coding >Pro_DTO377G3_2|g5528.t1
ATGGGCGACACCCAAAGTCTACGTCCCTTAGAACGGTCTGTGCTCATTCTCTATGGCTCCGAAACGGGCAATGCG
CAGGAAGTGGCCGAGGAATTGGGCGCCTTGACTGAGCGACTCCGTTTTGCGACGCATGTATCCGAGTTGAATCAA
TGCAAGCCGGAGTCCCTTTTTTCATACACACTCACCATATTTGTGGCCTCGACTACCGGGCAAGGCGATTTGCCG
GCCAATGCGCGGTCTTTTTGGAAGTCGCTCTTGTTGAAAAAGCTACCTGCTACCTTCTTGAATGGCATAAATTTC
ACTTGTTTTGGGCTGGGGGATAGCTCGTATCCCAAATTCAACTGGGCGATACGCAAGCTCTATAAACGACTATTA
CAACTAGGCGCAAATGAGATCTATCCCACAGGCGAGGCAGACCAGCAACATCCAGAAGGACTCGAGGGAACTTTC
CTACCATGGATGACGGACTTCCGAAAACATTTGCTAGATAGACATCCTCTCCCTGATGGACAGCACCCGATCCCA
GACGATGTGCAGCTCCCACCAAAATGGAAGTTGCAATTAGCGGTGGAAAACGATTCGGCCCCAATACCCCAAGCT
GCAGTCGCAAATGAACATCAAGCTTCTACGGATGAATATCCGGGACTATACCATCTGGACCATGACTCCCGACCT
ATCCCACATACGCTATGTGCGACATTGACTGAAAATCGGCGCGCGACTCCGCAAAAGCATTGGCAGGATGTGCGC
CACATTACCCTGACCGTCCCAGGCCTTGTCTCTTACGTTCCTGGAGACATGATCGCCATCACACCGAAAAGCTCT
TCGATTGATGTCCAAACCCTTATTGATTTGATGGGTTGGAACGATCAGGCAGATCGACCAATCTCTCTCGTTCCA
ATGGGAGATATTCCATCACCGCCACCCATTCCTGGCCTCGACTCATATCCCAACCTCACTCTTCGCGCTCTCCTC
GTAGACTATCTCGACGTCAAGGGAATACCCCGCCGGTCCTTCTTCTCGACGATTGCACATTACACCAACGATGAA
ATGCACAAAGAACGGTTACTAGAATTTACAAATCCGGAATATCTCGACGAGCTATGGGATTACACGACACGCCCA
CGACGTAGTATACTTGAGATCTTGCATGAGTTCGACAGTGTCAAAATTCCCTGGCAGCACGCAATATCTGTTATC
CCGGCCATGCGCGCCCGCCAGTTTAGCATTGCCAGCGGCGGAAAACGCAAGCAGACTGCTGATGGCAATACACAG
TTCGAATTACTCATTGCCATTGTCAAATACCAGACAGTAATCAAGAGAATCCGCGAGGGAGTCTGTACCAAGTAT
CTTTCCGTGCTCCGGCCAGGGAGCACCCTTCAAGTCCAGCTCCAACCCGGCGGGCTCAAGTCATCAGTTCAGCAA
CTAACCGCAGCAACCGTGCTTATTGGACCGGGCACTGGAATTGCACCCCTGCGCTCCATCCTCTGGGAGAAAGCG
GCACTTGTGCAGGCTTACCGCGAGCAAAACCCTGACGTCAATCCACCGATCGGCCCGACAATTCTCCTATACGGA
GGCCGAAACCGAGAATCCGACTTCTTCTTCGAGGAAGAGTGGACGGAGCTCAGTAAGCTCATCCCGCTGCAGGTG
ATTACTGCTTTTTCGCGTGATCAGCAACGCAAGGTCTACGTGCAAGATACCATTCGCGAGAACTTCGCGCTCTTC
TTCTGTGTGTTGCATGATATGCAGGGGTCGGTTTACATTTGTGGTTCCTCGGGCCGCATGCCGCAAGCTGTGCGC
GAGGCGCTCATCGAAACCTTCCAAAATGGAGGAGCTCCTTTGCCGGGGCAACCTTTCACCCGTTCTCAGGCTGAG
GGCTATCTCATTAGCATGGAGCAGACTGGCCGTTACAAACAAGAGACTTGGTGA
Transcript >Pro_DTO377G3_2|g5528.t1
ATGGGCGACACCCAAAGTCTACGTCCCTTAGAACGGTCTGTGCTCATTCTCTATGGCTCCGAAACGGGCAATGCG
CAGGAAGTGGCCGAGGAATTGGGCGCCTTGACTGAGCGACTCCGTTTTGCGACGCATGTATCCGAGTTGAATCAA
TGCAAGCCGGAGTCCCTTTTTTCATACACACTCACCATATTTGTGGCCTCGACTACCGGGCAAGGCGATTTGCCG
GCCAATGCGCGGTCTTTTTGGAAGTCGCTCTTGTTGAAAAAGCTACCTGCTACCTTCTTGAATGGCATAAATTTC
ACTTGTTTTGGGCTGGGGGATAGCTCGTATCCCAAATTCAACTGGGCGATACGCAAGCTCTATAAACGACTATTA
CAACTAGGCGCAAATGAGATCTATCCCACAGGCGAGGCAGACCAGCAACATCCAGAAGGACTCGAGGGAACTTTC
CTACCATGGATGACGGACTTCCGAAAACATTTGCTAGATAGACATCCTCTCCCTGATGGACAGCACCCGATCCCA
GACGATGTGCAGCTCCCACCAAAATGGAAGTTGCAATTAGCGGTGGAAAACGATTCGGCCCCAATACCCCAAGCT
GCAGTCGCAAATGAACATCAAGCTTCTACGGATGAATATCCGGGACTATACCATCTGGACCATGACTCCCGACCT
ATCCCACATACGCTATGTGCGACATTGACTGAAAATCGGCGCGCGACTCCGCAAAAGCATTGGCAGGATGTGCGC
CACATTACCCTGACCGTCCCAGGCCTTGTCTCTTACGTTCCTGGAGACATGATCGCCATCACACCGAAAAGCTCT
TCGATTGATGTCCAAACCCTTATTGATTTGATGGGTTGGAACGATCAGGCAGATCGACCAATCTCTCTCGTTCCA
ATGGGAGATATTCCATCACCGCCACCCATTCCTGGCCTCGACTCATATCCCAACCTCACTCTTCGCGCTCTCCTC
GTAGACTATCTCGACGTCAAGGGAATACCCCGCCGGTCCTTCTTCTCGACGATTGCACATTACACCAACGATGAA
ATGCACAAAGAACGGTTACTAGAATTTACAAATCCGGAATATCTCGACGAGCTATGGGATTACACGACACGCCCA
CGACGTAGTATACTTGAGATCTTGCATGAGTTCGACAGTGTCAAAATTCCCTGGCAGCACGCAATATCTGTTATC
CCGGCCATGCGCGCCCGCCAGTTTAGCATTGCCAGCGGCGGAAAACGCAAGCAGACTGCTGATGGCAATACACAG
TTCGAATTACTCATTGCCATTGTCAAATACCAGACAGTAATCAAGAGAATCCGCGAGGGAGTCTGTACCAAGTAT
CTTTCCGTGCTCCGGCCAGGGAGCACCCTTCAAGTCCAGCTCCAACCCGGCGGGCTCAAGTCATCAGTTCAGCAA
CTAACCGCAGCAACCGTGCTTATTGGACCGGGCACTGGAATTGCACCCCTGCGCTCCATCCTCTGGGAGAAAGCG
GCACTTGTGCAGGCTTACCGCGAGCAAAACCCTGACGTCAATCCACCGATCGGCCCGACAATTCTCCTATACGGA
GGCCGAAACCGAGAATCCGACTTCTTCTTCGAGGAAGAGTGGACGGAGCTCAGTAAGCTCATCCCGCTGCAGGTG
ATTACTGCTTTTTCGCGTGATCAGCAACGCAAGGTCTACGTGCAAGATACCATTCGCGAGAACTTCGCGCTCTTC
TTCTGTGTGTTGCATGATATGCAGGGGTCGGTTTACATTTGTGGTTCCTCGGGCCGCATGCCGCAAGCTGTGCGC
GAGGCGCTCATCGAAACCTTCCAAAATGGAGGAGCTCCTTTGCCGGGGCAACCTTTCACCCGTTCTCAGGCTGAG
GGCTATCTCATTAGCATGGAGCAGACTGGCCGTTACAAACAAGAGACTTGGTGA
Gene >Pro_DTO377G3_2|g5528.t1
ATGGGCGACACCCAAAGTCTACGTCCCTTAGAACGGTCTGTGCTCATTCTCTATGGCTCCGAAACGGGCAATGCG
CAGGAAGTGGCCGAGGAATTGGGCGCCTTGACTGAGCGACTCCGTTTTGCGACGCATGTATCCGAGTTGAATCAA
TGCAAGCCGGTATGCACTTATCCGCAAGACAATGATCCTCTACAGACCTAATACCTCTGAAATTATAGGAGTCCC
TTTTTTCATACACACTCACCATATTTGTGGCCTCGACTACCGGGCAAGGCGATTTGCCGGCCAATGCGCGGTCTT
TTTGGAAGTCGCTCTTGTTGAAAAAGCTACCTGCTACCTTCTTGAATGGCATAAATTTCACTTGTTTTGGGCTGG
GGGATAGCTCGTATCCCAAGTATGGAACCTATACCACAATTGTGGTTTTCAATGGCTGATTGTGATAGATTCAAC
TGGGCGATACGCAAGCTCTATAAACGACTATTACAACTAGGCGCAAATGAGATCTATCCCACAGGCGAGGCAGAC
CAGCAACATCCAGAAGGGTGAGTACTATCTTGATCTTCACGCTATATGTCCACGACTTACGTGGGTTTGACACAC
AGACTCGAGGGAACTTTCCTACCATGGATGACGGACTTCCGAAAACATTTGCTAGATAGACATCCTCTCCCTGAT
GGACAGCACCCGATCCCAGACGATGTGCAGCTCCCACCAAAATGGAAGTTGCAATTAGCGGTGGAAAACGATTCG
GCCCCAATACCCCAAGCTGCAGTCGCAAATGAACATCAAGCTTCTACGGATGAATATCCGGGACTATACCATCTG
GACCATGACTCCCGACCTATCCCACATACGCTATGTGCGACATTGACTGAAAATCGGCGCGCGACTCCGCAAAAG
CATTGGCAGGATGTGCGCCACATTACCCTGACCGTCCCAGGCCTTGTCTCTTACGTTCCTGGAGACATGATCGCC
ATCACACCGAAAAGCTCTTCGATTGATGTCCAAACCCTTATTGATTTGATGGGTTGGAACGATCAGGCAGATCGA
CCAATCTCTCTCGTTCCAATGGGAGATATTCCATCACCGCCACCCATTCCTGGCCTCGACTCATATCCCAACCTC
ACTCTTCGCGCTCTCCTCGTAGACTATCTCGACGTCAAGGGAATACCCCGCCGGTCCTTCTTCTCGACGATTGCA
CATTACACCAACGATGAAATGCACAAAGAACGGTTACTAGAATTTACAAATCCGGAATATCTCGACGAGCTATGG
GATTACACGACACGCCCACGACGTAGTATACTTGAGATCTTGCATGAGTTCGACAGTGTCAAAATTCCCTGGCAG
CACGCAATATCTGTTATCCCGGCCATGCGCGCCCGCCAGTTTAGCATTGCCAGCGGCGGAAAACGCAAGCAGACT
GCTGATGGCAATACACAGTTCGAATTACTCATTGCCATTGTCAAATACCAGACAGTAATCAAGAGAATCCGCGAG
GGAGTCTGTACCAAGTATCTTTCCGTGCTCCGGCCAGGGAGCACCCTTCAAGTCCAGCTCCAACCCGGCGGGCTC
AAGTCATCAGTTCAGCAACTAACCGCAGCAACCGTGCTTATTGGACCGGGCACTGGAATTGCACCCCTGCGCTCC
ATCCTCTGGGAGAAAGCGGCACTTGTGCAGGCTTACCGCGAGCAAAACCCTGACGTCAATCCACCGATCGGCCCG
ACAATTCTCCTATACGGAGGCCGAAACCGAGAATCCGACTTCTTCTTCGAGGAAGAGTGGACGGAGCTCAGTAAG
CTCATCCCGCTGCAGGTGATTACTGCTTTTTCGCGTGATCAGCAACGCAAGGTCTACGTGCAAGATACCATTCGC
GAGAACTTCGCGCTCTTCTTCTGTGTGTTGCATGATATGCAGGGGTCGGTTTACATTTGTGGTTCCTCGGGCCGC
ATGCCGCAAGCTGTGCGCGAGGCGCTCATCGAAACCTTCCAAAATGGAGGAGCTCCTTTGCCGGGGCAACCTTTC
ACCCGTTCTCAGGCTGAGGGCTATCTCATTAGCATGGAGCAGACTGGCCGTTACAAACAAGAGACTTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail