Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g552.t1
Gene name
Locationscaffold_01:1424035..1425961
Strand+
Gene length (bp)1926
Transcript length (bp)1743
Coding sequence length (bp)1743
Protein length (aa) 581

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 7.3E-22 146 415

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 149 171 22
2 181 203 22
3 224 246 22
4 261 283 22
5 290 312 22
6 349 368 19
7 381 403 22
8 444 466 22
9 533 555 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g552.t1
MAGNIFGANAGAATDAHLHEKEKTDTNDPAVSISREPPSEISDGNRSIYLDSSITFENYVYWAKRSREIEKHIST
DDVGFAHLSNKLFRKKKSDALVIMQGEIEEQDASVMKESSKPTNTMNGASTSDNWGITETEWEQAQRAARTATWG
SIFYLISTDILGPTNVPWAISQMGFGPGAVLYTVFGAMACYSGLQLWRIFIGLDSTRFPMRNYGDMAFRIYGDWA
RIFVNVLQSFQFFLNVALLIVSNGQGLAQMAVGANGNGFLCFIAAEVIFMAIGFLLGQIRTLQRLSYLANIAVWL
NVIVIIMTMVVVHEYPPNYSASLTSYGTQKGPVQTSGYWPASSTLNDKVNAMMNAVFAYGGATLFNELMAEMRRP
YDFWKGFIIAEIFIYVCYLVSGMVVYSAQGQFTFNPAYQGIPNSAYRFQTLGTPSHLSPASSQPCSMATLWVWIG
LVPAYWALAWVVAAAIPQITNLTSFVGAACILQFSYTFPPMLLVGFNVQNDAILPDEINSTTGQVQRIDSGIKRW
IRGYKKKFVWNTFDVIYSLLALSAAGLGIWASVTSMHTSFEEGKLTHFTCANPAG*
Coding >Pro_DTO377G3_2|g552.t1
ATGGCAGGCAATATCTTCGGCGCCAACGCGGGTGCTGCAACCGACGCTCATCTGCACGAGAAAGAAAAAACGGAC
ACCAATGACCCTGCCGTCTCGATTTCTCGCGAGCCCCCGTCTGAAATTTCCGATGGCAATCGTTCGATCTACTTG
GATTCTAGCATCACCTTCGAGAACTACGTCTACTGGGCTAAGCGGTCGCGCGAGATTGAAAAGCACATCTCGACT
GACGATGTGGGATTTGCGCACTTGAGCAACAAGCTTTTTCGTAAAAAAAAGTCGGACGCTCTAGTGATAATGCAG
GGAGAGATTGAGGAACAGGATGCCTCCGTCATGAAGGAGTCCAGCAAACCTACCAACACAATGAACGGCGCTAGC
ACAAGTGACAATTGGGGCATCACGGAGACAGAATGGGAACAGGCACAGCGGGCCGCGCGAACTGCAACATGGGGT
TCGATCTTCTATCTCATTTCCACGGACATCCTTGGACCGACCAATGTCCCCTGGGCAATCAGTCAGATGGGCTTC
GGACCGGGAGCTGTACTTTACACTGTTTTCGGCGCCATGGCTTGTTATTCCGGCTTGCAACTGTGGAGGATCTTC
ATCGGTCTTGACTCGACTCGATTCCCGATGCGCAATTATGGCGATATGGCTTTCCGTATCTACGGAGACTGGGCG
CGCATTTTTGTGAACGTCCTCCAAAGCTTCCAGTTCTTCCTCAATGTGGCCCTGCTTATTGTAAGCAACGGACAA
GGGCTGGCGCAGATGGCTGTCGGTGCCAATGGCAATGGGTTCCTTTGTTTCATCGCTGCTGAGGTGATCTTCATG
GCCATCGGCTTTTTGCTCGGGCAGATCCGTACCCTGCAGCGCCTTTCTTACTTGGCCAACATTGCGGTCTGGCTG
AATGTCATTGTCATCATCATGACCATGGTTGTGGTTCATGAGTATCCCCCTAACTACTCAGCCTCGCTGACTAGC
TATGGGACCCAAAAGGGACCCGTGCAGACAAGCGGGTACTGGCCTGCGAGCTCAACCCTCAACGACAAAGTCAAT
GCTATGATGAACGCGGTTTTCGCGTACGGCGGTGCAACCCTCTTCAATGAGCTCATGGCTGAGATGAGACGGCCC
TATGACTTCTGGAAGGGCTTTATCATTGCCGAGATATTCATCTACGTTTGCTACCTTGTCTCGGGTATGGTTGTG
TATAGTGCGCAGGGCCAATTTACATTCAATCCTGCATACCAGGGTATTCCAAACTCTGCCTACAGGTTCCAGACT
TTAGGAACGCCATCTCATTTATCACCGGCGTCATCGCAGCCTTGCTCTATGGCAACATTGTGGGTGTGGATTGGT
CTCGTGCCTGCCTACTGGGCTCTTGCCTGGGTGGTTGCCGCCGCAATCCCGCAAATCACCAATCTAACATCCTTC
GTGGGAGCCGCCTGCATCTTGCAGTTTTCTTACACGTTCCCACCAATGTTGCTGGTTGGGTTCAACGTCCAGAAT
GATGCGATACTGCCTGATGAGATCAATTCGACAACCGGCCAGGTGCAGCGCATAGACAGCGGAATCAAGAGATGG
ATTAGAGGTTACAAGAAGAAGTTTGTGTGGAACACTTTTGATGTAATCTACTCGCTTCTTGCTTTGTCTGCCGCT
GGTCTGGGAATTTGGGCTTCGGTCACTTCCATGCACACCAGTTTCGAGGAGGGTAAGCTGACCCATTTCACTTGT
GCGAACCCGGCTGGATAG
Transcript >Pro_DTO377G3_2|g552.t1
ATGGCAGGCAATATCTTCGGCGCCAACGCGGGTGCTGCAACCGACGCTCATCTGCACGAGAAAGAAAAAACGGAC
ACCAATGACCCTGCCGTCTCGATTTCTCGCGAGCCCCCGTCTGAAATTTCCGATGGCAATCGTTCGATCTACTTG
GATTCTAGCATCACCTTCGAGAACTACGTCTACTGGGCTAAGCGGTCGCGCGAGATTGAAAAGCACATCTCGACT
GACGATGTGGGATTTGCGCACTTGAGCAACAAGCTTTTTCGTAAAAAAAAGTCGGACGCTCTAGTGATAATGCAG
GGAGAGATTGAGGAACAGGATGCCTCCGTCATGAAGGAGTCCAGCAAACCTACCAACACAATGAACGGCGCTAGC
ACAAGTGACAATTGGGGCATCACGGAGACAGAATGGGAACAGGCACAGCGGGCCGCGCGAACTGCAACATGGGGT
TCGATCTTCTATCTCATTTCCACGGACATCCTTGGACCGACCAATGTCCCCTGGGCAATCAGTCAGATGGGCTTC
GGACCGGGAGCTGTACTTTACACTGTTTTCGGCGCCATGGCTTGTTATTCCGGCTTGCAACTGTGGAGGATCTTC
ATCGGTCTTGACTCGACTCGATTCCCGATGCGCAATTATGGCGATATGGCTTTCCGTATCTACGGAGACTGGGCG
CGCATTTTTGTGAACGTCCTCCAAAGCTTCCAGTTCTTCCTCAATGTGGCCCTGCTTATTGTAAGCAACGGACAA
GGGCTGGCGCAGATGGCTGTCGGTGCCAATGGCAATGGGTTCCTTTGTTTCATCGCTGCTGAGGTGATCTTCATG
GCCATCGGCTTTTTGCTCGGGCAGATCCGTACCCTGCAGCGCCTTTCTTACTTGGCCAACATTGCGGTCTGGCTG
AATGTCATTGTCATCATCATGACCATGGTTGTGGTTCATGAGTATCCCCCTAACTACTCAGCCTCGCTGACTAGC
TATGGGACCCAAAAGGGACCCGTGCAGACAAGCGGGTACTGGCCTGCGAGCTCAACCCTCAACGACAAAGTCAAT
GCTATGATGAACGCGGTTTTCGCGTACGGCGGTGCAACCCTCTTCAATGAGCTCATGGCTGAGATGAGACGGCCC
TATGACTTCTGGAAGGGCTTTATCATTGCCGAGATATTCATCTACGTTTGCTACCTTGTCTCGGGTATGGTTGTG
TATAGTGCGCAGGGCCAATTTACATTCAATCCTGCATACCAGGGTATTCCAAACTCTGCCTACAGGTTCCAGACT
TTAGGAACGCCATCTCATTTATCACCGGCGTCATCGCAGCCTTGCTCTATGGCAACATTGTGGGTGTGGATTGGT
CTCGTGCCTGCCTACTGGGCTCTTGCCTGGGTGGTTGCCGCCGCAATCCCGCAAATCACCAATCTAACATCCTTC
GTGGGAGCCGCCTGCATCTTGCAGTTTTCTTACACGTTCCCACCAATGTTGCTGGTTGGGTTCAACGTCCAGAAT
GATGCGATACTGCCTGATGAGATCAATTCGACAACCGGCCAGGTGCAGCGCATAGACAGCGGAATCAAGAGATGG
ATTAGAGGTTACAAGAAGAAGTTTGTGTGGAACACTTTTGATGTAATCTACTCGCTTCTTGCTTTGTCTGCCGCT
GGTCTGGGAATTTGGGCTTCGGTCACTTCCATGCACACCAGTTTCGAGGAGGGTAAGCTGACCCATTTCACTTGT
GCGAACCCGGCTGGATAG
Gene >Pro_DTO377G3_2|g552.t1
ATGGCAGGCAATATCTTCGGCGCCAACGCGGGTGCTGCAACCGACGCTCATCTGCACGAGAAAGAAAAAACGGAC
ACCAATGACCCTGCCGTCTCGATTTCTCGCGAGCCCCCGTCTGAAATTTCCGATGGCAATCGTTCGATCTACTTG
GATTCTAGCATCACCTTCGAGAACTACGTCTACTGGGCTAAGCGGTCGCGCGAGATTGAAAAGCACATCTCGACT
GACGATGTGGGATTTGCGCACTTGAGCAACAAGCTTTTTCGTAAAAAAAAGTCGGACGCTCTAGTGATAATGCAG
GGAGAGATTGAGGAACAGGATGCCTCCGTCATGAAGGAGTCCAGCAAACCTACCAACACAATGAACGGCGCTAGC
ACAAGTGACAATTGGGGCATCACGGAGACAGAATGGGAACAGGCACAGCGGGCCGCGCGAACTGCAACATGGGGT
TCGATCTTCTATCTCATTTCCACGGACATCCTTGGACCGACCAATGTCCCCTGGGCAATCAGTCAGATGGGCTTC
GGACCGGGAGCTGTACTTTACACTGTTTTCGGCGCCATGGCTTGTTATTCCGGCTTGCAACTGTGGAGGATCTTC
ATCGGTCTTGACTCGACTCGATTCCCGATGCGCAATTATGGCGATATGGCTTTCCGTATCTACGGAGACTGGGCG
CGCATTTTTGTGAACGTCCTCCAAAGCTTCCAGTTCTTCCTCAATGTGGCCCTGCTTATTGTAAGCAACGGACAA
GGGCTGGCGCAGATGGCTGTCGGTGCCAATGGCAATGGGTTCCTTTGTTTCATCGCTGCTGAGGTGATCTTCATG
GCCATCGGCTTTTTGCTCGGGCAGATCCGTACCCTGCAGCGCCTTTCTTACTTGGCCAACATTGCGGTCTGGCTG
AATGTCATTGTCATCATCATGACCATGGTTGTGGTTCATGAGTATCCCCCTAACTACTCAGCCTCGCTGACTAGC
TATGGGACCCAAAAGGGACCCGTGCAGACAAGCGGGTACTGGCCTGCGAGCTCAACCCTCAACGACAAAGTCAAT
GCTATGATGAACGCGGTTTTCGCGTACGGCGGTGCAACCCTCTTCAATGAGCTCATGGCTGAGATGAGACGGCCC
TATGACTTCTGGAAGGGCTTTATCATTGCCGAGATATTCATCTACGTTTGCTACCTTGTCTCGGGTATGGTTGTG
TATAGTGCGCAGGGCCAATTTACATTCAATCCTGCATACCAGGGTAAGTCGCATAGCTTCCACTGGAGATCTTGA
GATTGCTAACAACCACGCAACAGGTATTCCAAACTCTGCCTACAGGTTCCAGACTTTAGGAACGCCATCTCATTT
ATCACCGGCGTCATCGCAGCCTTGCTCTATGGCAACATTGGTATCAAAGTCTTCTACTCCGCAGTTTTCCGCGAC
GTCTTCCGTTTCCCAGAATTAAACAGCCGAACTGGCAAGTGGGTGTGGATTGGTCTCGGTAAGCTCAGATATGCA
TCCCCTCTATCTGTGCACGCATTGATAATCCCTCTAGTGCCTGCCTACTGGGCTCTTGCCTGGGTGGTTGCCGCC
GCAATCCCGCAAATCACCAATCTAACATCCTTCGTGGGAGCCGCCTGCATCTTGCAGTTTTCTTACACGTTCCCA
CCAATGTTGCTGGTTGGGTTCAACGTCCAGAATGATGCGATACTGCCTGATGAGATCAATTCGACAACCGGCCAG
GTGCAGCGCATAGACAGCGGAATCAAGAGATGGATTAGAGGTTACAAGAAGAAGTTTGTGTGGAACACTTTTGAT
GTAATCTACTCGCTTCTTGCTTTGTCTGCCGCTGGTCTGGGAATTTGGGCTTCGGTCACTTCCATGCACACCAGT
TTCGAGGAGGGTAAGCTGACCCATTTCACTTGTGCGAACCCGGCTGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail