Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5512.t1
Gene name
Locationscaffold_13:317001..318393
Strand+
Gene length (bp)1392
Transcript length (bp)1128
Coding sequence length (bp)1128
Protein length (aa) 376

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.7E-14 45 113
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.4E-12 220 301

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 112.49 68.90 156.07
5d_25C Five days - 25 degrees Celsius 142.98 87.97 197.98
7d_25C Seven days - 25 degrees Celsius 150.52 92.22 208.83
10d_25C Ten days - 25 degrees Celsius 229.31 139.28 319.34
7d_15C Seven days - 15 degrees Celsius 160.16 98.44 221.88
7d_30C Seven days - 30 degrees Celsius 138.00 84.89 191.11

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.294532 no
3d_25C 7d_25C 0.180490 no
3d_25C 7d_15C 0.091039 no
3d_25C 7d_30C 0.392296 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.871113 no
5d_25C 7d_15C 0.679253 no
5d_25C 7d_30C 0.914945 no
5d_25C 10d_25C 0.016634 yes
7d_25C 7d_15C 0.838832 no
7d_25C 7d_30C 0.761952 no
7d_25C 10d_25C 0.035881 yes
7d_15C 7d_30C 0.565665 no
7d_15C 10d_25C 0.087424 no
7d_30C 10d_25C 0.009124 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5512.t1
MSEVDTLADSVAATTLTDKPEINGATPSTQAADAAAASADEGRRLYIGNLAYATTEDELKEFFKTYTIETTSIPV
NPRTNRPVGYAFVDIATALEAAAAIEALSGKEILQRKVSVQLARKPDIAEPKEGAASGGEGAEARKRAAGRGRAR
GRARGRGGRTGRSRAAQEGQEATEAPASETPLADTTNDKDTASKAGDARAARPQKQRGPPEDGIPSKTKVMVANL
PYDLTEDKLKEIFAAYEPVSAKVALRPIPRFMIKKLQARNERRKTRGFGFVNLASEELQAKAVSEMNGKDIDGRV
IAVKVAIDSPGKEDDDINAVAETEETAAPASDAASAPAAAAAPAPAADADAAGAADAPAPAAAKENTAPSVTTEA
*
Coding >Pro_DTO377G3_2|g5512.t1
ATGTCTGAAGTCGATACACTTGCTGACTCCGTGGCTGCGACCACTCTGACCGATAAGCCCGAAATCAACGGTGCT
ACCCCTTCCACTCAGGCAGCTGATGCCGCGGCTGCCAGTGCAGATGAGGGTCGTCGTCTTTACATCGGGAATCTC
GCATACGCGACAACCGAGGACGAGCTTAAGGAGTTCTTCAAGACCTACACTATTGAGACCACCTCGATCCCGGTG
AACCCCCGCACCAACCGTCCCGTTGGCTATGCATTTGTGGATATCGCCACCGCCCTTGAAGCTGCTGCTGCTATC
GAGGCCCTTTCTGGCAAGGAGATTCTTCAGCGCAAGGTGTCCGTGCAGCTTGCCCGCAAGCCCGACATCGCCGAG
CCCAAGGAAGGTGCTGCCAGTGGTGGTGAGGGTGCCGAGGCTCGCAAGCGTGCTGCTGGTCGCGGCCGTGCCCGT
GGCCGTGCCCGCGGTCGTGGTGGCCGTACCGGCCGTAGCCGTGCTGCCCAGGAAGGCCAGGAAGCCACCGAGGCC
CCTGCCAGCGAGACTCCTCTTGCTGACACCACCAACGATAAGGATACTGCCTCCAAGGCTGGTGACGCCCGCGCT
GCACGCCCCCAGAAGCAGCGCGGTCCTCCCGAGGATGGCATTCCTTCTAAGACTAAGGTCATGGTTGCCAACCTG
CCGTACGACTTGACCGAGGACAAGCTCAAGGAGATCTTCGCCGCCTACGAGCCCGTCTCTGCCAAGGTCGCCCTG
CGTCCTATCCCCCGTTTCATGATCAAGAAGTTGCAGGCTCGCAACGAGCGCCGCAAGACTCGTGGCTTCGGTTTC
GTCAACCTTGCCTCCGAGGAGCTCCAGGCCAAGGCCGTCAGCGAGATGAACGGCAAGGACATTGATGGTCGTGTC
ATCGCCGTGAAGGTCGCCATCGACAGCCCGGGTAAGGAAGATGATGATATTAACGCTGTGGCTGAGACTGAGGAG
ACTGCTGCTCCTGCTTCTGATGCTGCCTCTGCTCCTGCTGCTGCTGCTGCTCCTGCTCCTGCTGCTGATGCTGAT
GCAGCTGGTGCGGCTGATGCTCCCGCTCCTGCTGCTGCCAAGGAGAACACTGCTCCTTCCGTCACCACTGAGGCT
TAA
Transcript >Pro_DTO377G3_2|g5512.t1
ATGTCTGAAGTCGATACACTTGCTGACTCCGTGGCTGCGACCACTCTGACCGATAAGCCCGAAATCAACGGTGCT
ACCCCTTCCACTCAGGCAGCTGATGCCGCGGCTGCCAGTGCAGATGAGGGTCGTCGTCTTTACATCGGGAATCTC
GCATACGCGACAACCGAGGACGAGCTTAAGGAGTTCTTCAAGACCTACACTATTGAGACCACCTCGATCCCGGTG
AACCCCCGCACCAACCGTCCCGTTGGCTATGCATTTGTGGATATCGCCACCGCCCTTGAAGCTGCTGCTGCTATC
GAGGCCCTTTCTGGCAAGGAGATTCTTCAGCGCAAGGTGTCCGTGCAGCTTGCCCGCAAGCCCGACATCGCCGAG
CCCAAGGAAGGTGCTGCCAGTGGTGGTGAGGGTGCCGAGGCTCGCAAGCGTGCTGCTGGTCGCGGCCGTGCCCGT
GGCCGTGCCCGCGGTCGTGGTGGCCGTACCGGCCGTAGCCGTGCTGCCCAGGAAGGCCAGGAAGCCACCGAGGCC
CCTGCCAGCGAGACTCCTCTTGCTGACACCACCAACGATAAGGATACTGCCTCCAAGGCTGGTGACGCCCGCGCT
GCACGCCCCCAGAAGCAGCGCGGTCCTCCCGAGGATGGCATTCCTTCTAAGACTAAGGTCATGGTTGCCAACCTG
CCGTACGACTTGACCGAGGACAAGCTCAAGGAGATCTTCGCCGCCTACGAGCCCGTCTCTGCCAAGGTCGCCCTG
CGTCCTATCCCCCGTTTCATGATCAAGAAGTTGCAGGCTCGCAACGAGCGCCGCAAGACTCGTGGCTTCGGTTTC
GTCAACCTTGCCTCCGAGGAGCTCCAGGCCAAGGCCGTCAGCGAGATGAACGGCAAGGACATTGATGGTCGTGTC
ATCGCCGTGAAGGTCGCCATCGACAGCCCGGGTAAGGAAGATGATGATATTAACGCTGTGGCTGAGACTGAGGAG
ACTGCTGCTCCTGCTTCTGATGCTGCCTCTGCTCCTGCTGCTGCTGCTGCTCCTGCTCCTGCTGCTGATGCTGAT
GCAGCTGGTGCGGCTGATGCTCCCGCTCCTGCTGCTGCCAAGGAGAACACTGCTCCTTCCGTCACCACTGAGGCT
TAA
Gene >Pro_DTO377G3_2|g5512.t1
ATGTCTGAAGTCGATACACTTGCTGACTCCGTGGCTGCGACCACTCTGACCGATAAGCCCGAAATCAACGGTGCT
ACCCCTTCCACTCAGGCAGCTGATGCCGCGGCTGCCAGTGCAGATGAGGGTCGTCGTCTTTACATCGGGAATCTC
GCATACGCGACAACCGAGGACGAGCTTAAGGAGTTCTTCAAGACCTACACTATGTGAGTACTTCCCAAATTAGTG
TTTTCGTCCGAACAATCAATCCCACCCGGAGCAAACATTCAATCACGTGGCACCATCATTTATGGGACCATTTCT
AACTCCTTTCGTCTTAAAGTGAGACCACCTCGATCCCGGTGAACCCCCGCACCAACCGTCCCGTTGGCTATGCAT
TTGTGGATATCGCCACCGCCCTTGAAGCTGCTGCTGCTATCGAGGCCCTTTCTGGCAAGGAGATTCTTCAGCGCA
AGGTGTCCGTGCAGCTTGCCCGCAAGCCCGACATCGCCGAGCCCAAGGAAGGTGCTGCCAGTGGTGGTGAGGGTG
CCGAGGCTCGCAAGCGTGCTGCTGGTCGCGGCCGTGCCCGTGGCCGTGCCCGCGGTCGTGGTGGCCGTACCGGCC
GTAGCCGTGCTGTATGTGCCAAATATCTTTCCTTGCTTGAATCTACGCATATCGACACTTTGAAATGGATGCTGA
CACTCCCGAAGGCCCAGGAAGGCCAGGAAGCCACCGAGGCCCCTGCCAGCGAGACTCCTCTTGCTGACACCACCA
ACGATAAGGATACTGCCTCCAAGGCTGGTGACGCCCGCGCTGCACGCCCCCAGAAGCAGCGCGGTCCTCCCGAGG
ATGGCATTCCTTCTAAGACTAAGGTCATGGTTGCCAACCTGCCGTACGACTTGACCGAGGACAAGGTGGGTTATA
TCTATTCCTTTCGTCTGATCTCCGTCTGGGGTTACATTGACTGACATCCTTTTCTCCATTTAGCTCAAGGAGATC
TTCGCCGCCTACGAGCCCGTCTCTGCCAAGGTCGCCCTGCGTCCTATCCCCCGTTTCATGATCAAGAAGTTGCAG
GCTCGCAACGAGCGCCGCAAGACTCGTGGCTTCGGTTTCGTCAACCTTGCCTCCGAGGAGCTCCAGGCCAAGGCC
GTCAGCGAGATGAACGGCAAGGACATTGATGGTCGTGTCATCGCCGTGAAGGTCGCCATCGACAGCCCGGGTAAG
GAAGATGATGATATTAACGCTGTGGCTGAGACTGAGGAGACTGCTGCTCCTGCTTCTGATGCTGCCTCTGCTCCT
GCTGCTGCTGCTGCTCCTGCTCCTGCTGCTGATGCTGATGCAGCTGGTGCGGCTGATGCTCCCGCTCCTGCTGCT
GCCAAGGAGAACACTGCTCCTTCCGTCACCACTGAGGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail