Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5506.t1
Gene name
Locationscaffold_13:301293..302764
Strand-
Gene length (bp)1471
Transcript length (bp)1290
Coding sequence length (bp)1290
Protein length (aa) 430

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02784 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyridoxal binding domain 9.7E-62 59 287
PF00278 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-terminal sheet domain 8.5E-15 289 399

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5506.t1
MALLPALSETALTSKVIHATGYRNLPPDELVDLAIESHIARIVKRSLVGSDESFFIADLGQVLRQHRRWTQNMPG
IRPYYAVKCNCDPTFLKVLAELGTGFDCASIEEMRAVLSLGVDPARILFANPCKAPAAVAFARDIGVLRTTFDNI
DELDTIKAHMPEAQLLLRIYANDEGAFICLGEKFGAQLDTTEELLSRAWELGLNVIGVSFHVGTGAINPASFCKG
IKDARLAFSQAERLGFHPKILDIGGGFQDDCFESMAPIIRDAIRSEFPAGITTIAEPGRFFARSVYTLVCRVISR
RRQLGSAARSGVPDMLYQNDGIYGNFMNVIMEKEIMVPYLVSKKARGFLHKPKSGDALCIPHRYSIWGPTCDSTD
CVVREVTLDSEVKVGDWLKYKNMGAYTSTTATQFNGFSSTYDTFYVNSETLPDY*
Coding >Pro_DTO377G3_2|g5506.t1
ATGGCCCTTCTCCCTGCTCTTAGTGAAACTGCGCTCACTAGCAAGGTTATACATGCAACCGGATATCGAAATCTC
CCACCAGACGAGCTAGTCGACCTCGCAATTGAGAGTCACATTGCGCGTATAGTCAAACGCTCTCTCGTTGGCAGT
GACGAATCATTCTTCATCGCCGATTTGGGCCAGGTACTTCGACAGCATCGTCGTTGGACCCAGAACATGCCCGGA
ATCCGACCGTATTACGCGGTCAAATGCAATTGCGACCCAACCTTCCTCAAAGTCCTCGCAGAACTGGGGACGGGG
TTCGACTGCGCCTCCATTGAAGAGATGCGCGCAGTTCTCAGCCTCGGTGTAGATCCAGCCCGGATTCTGTTCGCC
AATCCCTGCAAAGCACCCGCCGCCGTAGCTTTCGCACGCGATATTGGTGTCTTGCGGACAACATTTGACAATATC
GACGAATTGGATACTATCAAGGCACACATGCCGGAAGCTCAGCTGTTGCTTCGGATCTACGCGAATGACGAGGGT
GCGTTCATATGTCTGGGCGAAAAGTTTGGTGCGCAGTTGGATACGACCGAGGAACTCCTTTCAAGAGCTTGGGAG
CTTGGATTGAATGTGATTGGTGTGAGCTTTCACGTTGGGACGGGTGCTATCAACCCAGCGTCATTTTGCAAGGGC
ATCAAAGATGCACGTCTGGCATTCTCACAAGCGGAACGTCTAGGTTTCCACCCCAAAATTCTCGATATCGGCGGT
GGCTTTCAAGACGATTGCTTCGAGTCTATGGCGCCTATTATTCGAGACGCAATTCGGTCGGAGTTTCCAGCTGGT
ATCACAACGATCGCAGAGCCAGGTCGGTTTTTCGCTCGTAGTGTGTATACTCTTGTATGTCGAGTGATTTCACGT
CGCCGTCAGCTTGGGAGTGCTGCTCGATCTGGTGTTCCAGACATGCTTTATCAAAATGATGGCATATATGGAAAT
TTCATGAATGTGATTATGGAGAAAGAGATCATGGTTCCTTATTTGGTCAGTAAGAAAGCCAGGGGGTTCTTGCAT
AAACCCAAATCAGGGGATGCTTTGTGCATCCCCCATCGGTACTCGATCTGGGGACCGACATGTGACAGCACCGAT
TGTGTTGTGCGCGAGGTGACGCTTGATTCTGAAGTCAAGGTTGGAGATTGGCTCAAATATAAAAACATGGGAGCA
TATACAAGTACCACTGCTACCCAGTTCAATGGCTTCAGCAGCACCTATGACACATTTTATGTCAACAGTGAAACG
TTGCCTGACTATTAG
Transcript >Pro_DTO377G3_2|g5506.t1
ATGGCCCTTCTCCCTGCTCTTAGTGAAACTGCGCTCACTAGCAAGGTTATACATGCAACCGGATATCGAAATCTC
CCACCAGACGAGCTAGTCGACCTCGCAATTGAGAGTCACATTGCGCGTATAGTCAAACGCTCTCTCGTTGGCAGT
GACGAATCATTCTTCATCGCCGATTTGGGCCAGGTACTTCGACAGCATCGTCGTTGGACCCAGAACATGCCCGGA
ATCCGACCGTATTACGCGGTCAAATGCAATTGCGACCCAACCTTCCTCAAAGTCCTCGCAGAACTGGGGACGGGG
TTCGACTGCGCCTCCATTGAAGAGATGCGCGCAGTTCTCAGCCTCGGTGTAGATCCAGCCCGGATTCTGTTCGCC
AATCCCTGCAAAGCACCCGCCGCCGTAGCTTTCGCACGCGATATTGGTGTCTTGCGGACAACATTTGACAATATC
GACGAATTGGATACTATCAAGGCACACATGCCGGAAGCTCAGCTGTTGCTTCGGATCTACGCGAATGACGAGGGT
GCGTTCATATGTCTGGGCGAAAAGTTTGGTGCGCAGTTGGATACGACCGAGGAACTCCTTTCAAGAGCTTGGGAG
CTTGGATTGAATGTGATTGGTGTGAGCTTTCACGTTGGGACGGGTGCTATCAACCCAGCGTCATTTTGCAAGGGC
ATCAAAGATGCACGTCTGGCATTCTCACAAGCGGAACGTCTAGGTTTCCACCCCAAAATTCTCGATATCGGCGGT
GGCTTTCAAGACGATTGCTTCGAGTCTATGGCGCCTATTATTCGAGACGCAATTCGGTCGGAGTTTCCAGCTGGT
ATCACAACGATCGCAGAGCCAGGTCGGTTTTTCGCTCGTAGTGTGTATACTCTTGTATGTCGAGTGATTTCACGT
CGCCGTCAGCTTGGGAGTGCTGCTCGATCTGGTGTTCCAGACATGCTTTATCAAAATGATGGCATATATGGAAAT
TTCATGAATGTGATTATGGAGAAAGAGATCATGGTTCCTTATTTGGTCAGTAAGAAAGCCAGGGGGTTCTTGCAT
AAACCCAAATCAGGGGATGCTTTGTGCATCCCCCATCGGTACTCGATCTGGGGACCGACATGTGACAGCACCGAT
TGTGTTGTGCGCGAGGTGACGCTTGATTCTGAAGTCAAGGTTGGAGATTGGCTCAAATATAAAAACATGGGAGCA
TATACAAGTACCACTGCTACCCAGTTCAATGGCTTCAGCAGCACCTATGACACATTTTATGTCAACAGTGAAACG
TTGCCTGACTATTAG
Gene >Pro_DTO377G3_2|g5506.t1
ATGGCCCTTCTCCCTGCTCTTAGTGAAACTGCGCTCACTAGCAAGGTTATACATGCAACCGGATATCGAAATCTC
CCACCAGACGAGCTAGTCGACCTCGCAATTGAGAGTCACATTGCGCGTATAGTCAAACGCTCTCTCGTTGGCAGT
GACGAATCATTCTTCATCGCCGATTTGGGCCAGGTACTTCGACAGCATCGTCGTTGGACCCAGAACATGCCCGGA
ATCCGACCGTATTACGGTACAACACCCCTCTTCTAGTCCGTTCCTATTTTTGGAATAGAAAAGTAACATCTTCCC
ACAGCGGTCAAATGCAATTGCGACCCAACCTTCCTCAAAGTCCTCGCAGAACTGGGGACGGGGTTCGACTGCGCC
TCCATTGAAGAGATGCGCGCAGTTCTCAGCCTCGGTGTAGATCCAGCCCGGATTCTGTTCGCCAATCCCTGCAAA
GCACCCGCCGCCGTAGCTTTCGCACGCGATATTGGTGTCTTGCGGACAACATTTGACAATATCGACGAATTGGAT
ACTATCAAGGCACACATGCCGGAAGCTCAGCTGTTGCTTCGGATCTACGCGAATGACGAGGGTGCGTTCATATGT
CTGGGCGAAAAGTTTGGTGCGCAGTTGGATACGACCGAGGAACTCCTTTCAAGAGCTTGGGAGCTTGGATTGAAT
GTGATTGGTGTGAGCTTTCACGTTGGTAAGCACCGGGGTACTTCGGACTTCTTAGCTGGTCAGATGTATTGACCA
TCCTGAACTATTAGGGACGGGTGCTATCAACCCAGCGTCATTTTGCAAGGGCATCAAAGATGCACGTCTGGCATT
CTCACAAGCGGAACGTCTAGGTTTCCACCCCAAAATTCTCGATATCGGCGGTGGCTTTCAAGACGATTGCTTCGA
GTCTATGGCGCCTATTATTCGAGACGCAATTCGGTCGGAGTTTCCAGCTGGTATCACAACGATCGCAGAGCCAGG
TCGGTTTTTCGCTCGTAGTGTGTATACTCTTGTATGTCGAGTGATTTCACGTCGCCGTCAGCTTGGGAGTGCTGC
TCGATCTGGTGTTCCAGACATGCTTTATCAAAATGATGGCATATATGGAAATTTCATGAATGTGATTATGGAGAA
AGAGATCATGGTTCCTTATTTGGTCAGTAAGAAAGCCAGGGGGTTCTTGCATAAACCCAAATCAGGGGATGCTTT
GTGCATCCCCCATCGGTACTCGATCTGGGGACCGACATGTGACAGCACCGATTGTGTTGTGCGCGAGGTGACGCT
TGATTCTGAAGTCAAGGTTGGAGATTGGCTCAAATATAAAAACATGGGAGGTGAGTATTGCCATATTATATTGGT
CTGGATTTTCAGAACTGACTGAGTTCCAGCATATACAAGTACCACTGCTACCCAGTTCAATGGCTTCAGCAGCAC
CTATGACACATTTTATGTCAACAGTGAAACGTTGCCTGACTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail