Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5494.t1
Gene name
Locationscaffold_13:268557..271977
Strand+
Gene length (bp)3420
Transcript length (bp)3420
Coding sequence length (bp)3420
Protein length (aa) 1140

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00156 Pribosyltran Phosphoribosyl transferase domain 1.8E-23 978 1114
PF04275 P-mevalo_kinase Phosphomevalonate kinase 1.0E-19 767 883
PF01565 FAD_binding_4 FAD binding domain 6.6E-15 309 443

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0005737 cytoplasm Yes
GO:0006695 cholesterol biosynthetic process Yes
GO:0016491 oxidoreductase activity Yes
GO:0004631 phosphomevalonate kinase activity Yes
GO:0009116 nucleoside metabolic process Yes
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:1902653 secondary alcohol biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No
GO:0016125 sterol metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0043168 anion binding No
GO:0044238 primary metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901657 glycosyl compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044464 cell part No
GO:0097159 organic cyclic compound binding No
GO:0006694 steroid biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0046165 alcohol biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0006066 alcohol metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008610 lipid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016301 kinase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:0016776 phosphotransferase activity, phosphate group as acceptor No
GO:0005488 binding No
GO:0044424 intracellular part No
GO:0050662 coenzyme binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0048037 cofactor binding No
GO:0009058 biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0043167 ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0009987 cellular process No
GO:0016126 sterol biosynthetic process No
GO:0008150 biological_process No
GO:1901615 organic hydroxy compound metabolic process No
GO:0000166 nucleotide binding No
GO:0044281 small molecule metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:1901265 nucleoside phosphate binding No
GO:1902652 secondary alcohol metabolic process No
GO:0008202 steroid metabolic process No
GO:0008203 cholesterol metabolic process No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5494.t1
MATLESLKCALRQKATATGSSPNQPLSDIQYNAGLDILLQGPTYQDFIIPQISRLLAPLLDSNIQISVLEIGPGS
KSVFGYLSGRLRRKIRKYTAFEPNGLLATGLEKWLCSKSEAESPLPCLESSPDVQRILFGVESDTNSTDTRDKDE
KFDVILSCHGMHDMMPKTRFIGQALEMLVKQPEGGMVVIFHRDLTLHLDGLACHRTACFPMGAVRVANSDEILDS
FAPFIAGFAMRDVEADKDTRIEWREVCRALGRSEAHPDHLLFSSPNIMSAFTHHATALPELTAQVPLLEGGKAVK
NREARLHHPASTVRPTEVRQIQQCVKWALKHGANLTVVGGGHSGHCLCPNVVSVDMSAFEQVHIITAEDSGLESG
LDSVPLVVAEAGCKVGDIVRKTMAAGMTVPLGARPSVGAGLWLQGGIGHLARIYGLACDAIVGAVMVSVDSSQAF
CIGRVPSQHWPAGAVRPENEADLLWAIKGAGTNFGIVVSVTFQAYAAPMFSIRNWVVPLSDNLEAQGRLSNFDKL
VARLPRNYSMDAYLYWDLGKLHLGVTMFESSTNGRTSGTSISTPTPAATLFEREDKFQVVDCVGLFDADMYMSGM
HSGQTSTNTSAFKRCLFLKSIGVMNVAKILLAAVETRPTPLCYLHLLQGGGAISDVAADATAFGCRDWDFACVIT
GVWPRDQDGTEVAQAAVRWVYKVASDLLPTSSGVYGADLGPDPRDAALAAKAFGSNRPRLARLKRSSDPHNVLAY
TCPLPKAPIEHKLVILVTGVSGAGKDYCADIWVSVFLEHTQKMIMARAVSISDATKREYAAATGADFNRLLQDRG
YKEEHRPALTAFFQNQVRHRPRLPEEHFLNVVNGAGDVHVLLITGMRDEAPVAAFSPLVPGSRLLEVRVNSSKAA
RLARRGCHGGDSDHGDKENGSRPGLVFNNDATGNDAARRFAEEYLIRFIDGDLQRLANMVRPVPDFPRPGVEFRH
VLNICQQPGGLALCTSLLQTHFTGEWAKVDVIVSCETGGFIYASALASRVDVPLVLIREAGKLPPPTVSVLKSTS
HISSTSSSNENRIEIEQDLIPRGASVVVVDDVLSTGNTLCAVLQLLGEVGIADVSVMVVAEFPVHRGREGLRQRG
FGVNVQSLLVFDGA*
Coding >Pro_DTO377G3_2|g5494.t1
ATGGCCACTCTCGAATCTCTCAAGTGTGCTCTTAGGCAAAAGGCCACCGCAACGGGGTCATCCCCGAATCAGCCA
TTATCAGACATCCAGTACAACGCTGGCCTCGATATCTTACTGCAGGGTCCAACATACCAAGACTTCATCATCCCT
CAGATCTCTCGGCTGCTCGCTCCTCTCTTGGACTCGAATATCCAGATATCGGTGCTAGAAATAGGACCCGGCTCA
AAGAGCGTATTTGGATATCTGTCTGGTCGTCTGAGGCGGAAAATCAGGAAATACACTGCATTCGAGCCCAATGGC
CTGCTTGCTACAGGGTTGGAAAAATGGCTTTGCTCGAAATCAGAGGCAGAGTCCCCGCTGCCCTGTCTGGAAAGC
TCGCCTGATGTCCAGCGAATTCTATTCGGTGTAGAGAGCGACACGAATAGTACTGATACGCGTGACAAGGACGAA
AAGTTTGATGTTATCCTATCTTGTCACGGCATGCATGACATGATGCCAAAAACCAGGTTCATCGGACAAGCGCTA
GAAATGCTGGTTAAGCAACCCGAAGGAGGAATGGTGGTGATTTTTCATCGCGACTTGACCCTACACCTCGACGGA
TTAGCGTGCCATCGTACCGCTTGTTTTCCTATGGGAGCTGTTCGCGTGGCTAATAGTGATGAGATACTGGATTCT
TTTGCTCCTTTCATCGCAGGGTTTGCCATGCGGGATGTGGAGGCGGACAAGGATACCCGAATTGAATGGCGTGAG
GTGTGCCGCGCCTTGGGCCGCTCGGAGGCTCACCCAGACCATCTATTATTCAGCTCGCCCAATATCATGTCGGCC
TTCACCCACCATGCGACCGCATTGCCGGAGCTGACAGCACAGGTGCCATTGTTGGAAGGAGGCAAAGCTGTTAAG
AACCGAGAGGCTCGTCTTCACCACCCCGCCTCGACTGTTAGGCCGACAGAGGTACGACAAATTCAGCAGTGTGTT
AAATGGGCTCTGAAGCACGGTGCTAATTTGACCGTCGTTGGCGGGGGTCACAGCGGCCACTGCCTATGTCCCAAC
GTCGTTTCGGTCGACATGAGCGCCTTTGAACAAGTGCATATTATCACAGCCGAGGATAGTGGACTAGAATCTGGT
CTTGATTCTGTTCCCTTGGTTGTCGCCGAGGCGGGCTGCAAGGTAGGGGATATTGTCCGCAAGACCATGGCAGCC
GGCATGACAGTGCCCTTAGGGGCCCGCCCAAGTGTAGGCGCGGGGCTATGGCTACAAGGCGGCATCGGGCACCTG
GCTAGGATATATGGGCTCGCGTGTGACGCCATCGTCGGTGCCGTGATGGTCAGCGTCGACTCTAGCCAAGCCTTT
TGCATCGGCCGTGTACCAAGCCAACACTGGCCGGCCGGTGCCGTGCGCCCAGAAAACGAAGCCGATCTGTTATGG
GCGATAAAAGGCGCTGGAACCAACTTCGGTATCGTAGTCAGCGTTACTTTCCAGGCTTACGCGGCTCCGATGTTC
TCGATTCGAAATTGGGTTGTCCCGCTGAGTGACAATCTCGAAGCGCAGGGCAGGCTCAGCAATTTTGATAAATTA
GTCGCGAGGCTTCCTCGGAACTATTCTATGGACGCATATCTGTATTGGGACCTCGGAAAGTTGCATCTTGGCGTG
ACCATGTTTGAATCTTCCACGAACGGGCGCACCTCTGGAACATCCATCTCCACGCCCACGCCAGCAGCAACACTT
TTCGAGCGGGAAGACAAATTTCAAGTCGTGGACTGCGTCGGCTTGTTTGACGCCGATATGTACATGTCCGGAATG
CACAGTGGGCAGACCAGCACCAATACATCAGCATTCAAGCGATGTTTATTCTTAAAAAGTATTGGCGTAATGAAT
GTCGCCAAAATATTGCTGGCAGCCGTTGAGACTCGCCCCACGCCACTGTGCTATCTCCATCTGCTACAAGGTGGC
GGAGCTATCAGTGACGTGGCGGCCGATGCGACTGCTTTCGGTTGTCGAGACTGGGACTTTGCCTGCGTGATCACT
GGCGTCTGGCCACGCGACCAAGATGGAACCGAAGTCGCACAAGCCGCCGTACGGTGGGTATATAAGGTCGCTAGC
GACTTGTTGCCCACGAGTAGCGGAGTTTACGGCGCAGACCTGGGGCCGGACCCTAGAGACGCCGCGCTGGCGGCC
AAGGCTTTTGGATCGAACCGGCCACGCCTGGCTCGCCTCAAGCGCAGCTCGGATCCGCATAATGTGCTAGCTTAC
ACCTGCCCGCTTCCTAAAGCGCCCATAGAACATAAGCTTGTCATTCTAGTCACAGGTGTAAGCGGCGCCGGTAAG
GATTATTGCGCCGACATCTGGGTCTCGGTATTCCTTGAACACACCCAGAAAATGATTATGGCGCGCGCAGTCAGC
ATTAGCGATGCGACCAAGCGAGAATACGCGGCGGCCACTGGTGCCGACTTCAACCGCCTGCTTCAAGACCGTGGC
TATAAAGAGGAACATCGGCCAGCGTTGACAGCGTTCTTCCAGAACCAAGTGCGACATCGACCTCGGTTGCCAGAG
GAGCATTTTCTAAATGTGGTAAACGGTGCCGGAGACGTACATGTGCTGCTAATCACCGGAATGAGAGATGAGGCG
CCAGTTGCAGCCTTCTCGCCTTTGGTGCCAGGCAGCAGACTGCTCGAGGTCCGGGTGAACAGTAGCAAAGCGGCA
CGGCTTGCCCGCCGAGGCTGCCATGGCGGTGATTCTGATCATGGTGACAAAGAGAATGGCAGCCGCCCTGGCCTC
GTCTTCAATAATGACGCGACCGGAAACGACGCGGCCAGAAGGTTTGCCGAAGAATACCTGATTCGCTTCATCGAT
GGAGACCTCCAGCGACTAGCCAACATGGTGCGTCCAGTACCTGACTTTCCACGCCCGGGCGTTGAATTCCGCCAT
GTGCTCAACATCTGCCAGCAGCCGGGTGGGCTAGCCCTGTGCACCTCTCTGCTACAGACTCACTTCACTGGTGAA
TGGGCCAAGGTTGACGTGATAGTGAGTTGTGAGACCGGCGGCTTCATCTATGCGTCGGCGTTGGCCTCGCGGGTT
GATGTGCCTTTGGTGCTGATTCGGGAAGCAGGGAAACTGCCGCCACCCACCGTTTCCGTCCTCAAGTCTACTTCG
CATATCTCTTCGACATCCAGTTCAAATGAGAATAGGATTGAGATAGAACAGGATTTGATCCCTAGAGGTGCTTCG
GTAGTGGTTGTGGATGATGTGCTCTCCACGGGGAATACACTCTGTGCGGTGCTACAGCTCCTAGGTGAAGTTGGC
ATCGCTGATGTCAGCGTTATGGTCGTGGCTGAGTTCCCTGTTCATCGCGGTCGGGAAGGGTTGCGCCAGCGTGGA
TTTGGCGTCAATGTCCAAAGCCTTTTGGTGTTTGACGGCGCCTAG
Transcript >Pro_DTO377G3_2|g5494.t1
ATGGCCACTCTCGAATCTCTCAAGTGTGCTCTTAGGCAAAAGGCCACCGCAACGGGGTCATCCCCGAATCAGCCA
TTATCAGACATCCAGTACAACGCTGGCCTCGATATCTTACTGCAGGGTCCAACATACCAAGACTTCATCATCCCT
CAGATCTCTCGGCTGCTCGCTCCTCTCTTGGACTCGAATATCCAGATATCGGTGCTAGAAATAGGACCCGGCTCA
AAGAGCGTATTTGGATATCTGTCTGGTCGTCTGAGGCGGAAAATCAGGAAATACACTGCATTCGAGCCCAATGGC
CTGCTTGCTACAGGGTTGGAAAAATGGCTTTGCTCGAAATCAGAGGCAGAGTCCCCGCTGCCCTGTCTGGAAAGC
TCGCCTGATGTCCAGCGAATTCTATTCGGTGTAGAGAGCGACACGAATAGTACTGATACGCGTGACAAGGACGAA
AAGTTTGATGTTATCCTATCTTGTCACGGCATGCATGACATGATGCCAAAAACCAGGTTCATCGGACAAGCGCTA
GAAATGCTGGTTAAGCAACCCGAAGGAGGAATGGTGGTGATTTTTCATCGCGACTTGACCCTACACCTCGACGGA
TTAGCGTGCCATCGTACCGCTTGTTTTCCTATGGGAGCTGTTCGCGTGGCTAATAGTGATGAGATACTGGATTCT
TTTGCTCCTTTCATCGCAGGGTTTGCCATGCGGGATGTGGAGGCGGACAAGGATACCCGAATTGAATGGCGTGAG
GTGTGCCGCGCCTTGGGCCGCTCGGAGGCTCACCCAGACCATCTATTATTCAGCTCGCCCAATATCATGTCGGCC
TTCACCCACCATGCGACCGCATTGCCGGAGCTGACAGCACAGGTGCCATTGTTGGAAGGAGGCAAAGCTGTTAAG
AACCGAGAGGCTCGTCTTCACCACCCCGCCTCGACTGTTAGGCCGACAGAGGTACGACAAATTCAGCAGTGTGTT
AAATGGGCTCTGAAGCACGGTGCTAATTTGACCGTCGTTGGCGGGGGTCACAGCGGCCACTGCCTATGTCCCAAC
GTCGTTTCGGTCGACATGAGCGCCTTTGAACAAGTGCATATTATCACAGCCGAGGATAGTGGACTAGAATCTGGT
CTTGATTCTGTTCCCTTGGTTGTCGCCGAGGCGGGCTGCAAGGTAGGGGATATTGTCCGCAAGACCATGGCAGCC
GGCATGACAGTGCCCTTAGGGGCCCGCCCAAGTGTAGGCGCGGGGCTATGGCTACAAGGCGGCATCGGGCACCTG
GCTAGGATATATGGGCTCGCGTGTGACGCCATCGTCGGTGCCGTGATGGTCAGCGTCGACTCTAGCCAAGCCTTT
TGCATCGGCCGTGTACCAAGCCAACACTGGCCGGCCGGTGCCGTGCGCCCAGAAAACGAAGCCGATCTGTTATGG
GCGATAAAAGGCGCTGGAACCAACTTCGGTATCGTAGTCAGCGTTACTTTCCAGGCTTACGCGGCTCCGATGTTC
TCGATTCGAAATTGGGTTGTCCCGCTGAGTGACAATCTCGAAGCGCAGGGCAGGCTCAGCAATTTTGATAAATTA
GTCGCGAGGCTTCCTCGGAACTATTCTATGGACGCATATCTGTATTGGGACCTCGGAAAGTTGCATCTTGGCGTG
ACCATGTTTGAATCTTCCACGAACGGGCGCACCTCTGGAACATCCATCTCCACGCCCACGCCAGCAGCAACACTT
TTCGAGCGGGAAGACAAATTTCAAGTCGTGGACTGCGTCGGCTTGTTTGACGCCGATATGTACATGTCCGGAATG
CACAGTGGGCAGACCAGCACCAATACATCAGCATTCAAGCGATGTTTATTCTTAAAAAGTATTGGCGTAATGAAT
GTCGCCAAAATATTGCTGGCAGCCGTTGAGACTCGCCCCACGCCACTGTGCTATCTCCATCTGCTACAAGGTGGC
GGAGCTATCAGTGACGTGGCGGCCGATGCGACTGCTTTCGGTTGTCGAGACTGGGACTTTGCCTGCGTGATCACT
GGCGTCTGGCCACGCGACCAAGATGGAACCGAAGTCGCACAAGCCGCCGTACGGTGGGTATATAAGGTCGCTAGC
GACTTGTTGCCCACGAGTAGCGGAGTTTACGGCGCAGACCTGGGGCCGGACCCTAGAGACGCCGCGCTGGCGGCC
AAGGCTTTTGGATCGAACCGGCCACGCCTGGCTCGCCTCAAGCGCAGCTCGGATCCGCATAATGTGCTAGCTTAC
ACCTGCCCGCTTCCTAAAGCGCCCATAGAACATAAGCTTGTCATTCTAGTCACAGGTGTAAGCGGCGCCGGTAAG
GATTATTGCGCCGACATCTGGGTCTCGGTATTCCTTGAACACACCCAGAAAATGATTATGGCGCGCGCAGTCAGC
ATTAGCGATGCGACCAAGCGAGAATACGCGGCGGCCACTGGTGCCGACTTCAACCGCCTGCTTCAAGACCGTGGC
TATAAAGAGGAACATCGGCCAGCGTTGACAGCGTTCTTCCAGAACCAAGTGCGACATCGACCTCGGTTGCCAGAG
GAGCATTTTCTAAATGTGGTAAACGGTGCCGGAGACGTACATGTGCTGCTAATCACCGGAATGAGAGATGAGGCG
CCAGTTGCAGCCTTCTCGCCTTTGGTGCCAGGCAGCAGACTGCTCGAGGTCCGGGTGAACAGTAGCAAAGCGGCA
CGGCTTGCCCGCCGAGGCTGCCATGGCGGTGATTCTGATCATGGTGACAAAGAGAATGGCAGCCGCCCTGGCCTC
GTCTTCAATAATGACGCGACCGGAAACGACGCGGCCAGAAGGTTTGCCGAAGAATACCTGATTCGCTTCATCGAT
GGAGACCTCCAGCGACTAGCCAACATGGTGCGTCCAGTACCTGACTTTCCACGCCCGGGCGTTGAATTCCGCCAT
GTGCTCAACATCTGCCAGCAGCCGGGTGGGCTAGCCCTGTGCACCTCTCTGCTACAGACTCACTTCACTGGTGAA
TGGGCCAAGGTTGACGTGATAGTGAGTTGTGAGACCGGCGGCTTCATCTATGCGTCGGCGTTGGCCTCGCGGGTT
GATGTGCCTTTGGTGCTGATTCGGGAAGCAGGGAAACTGCCGCCACCCACCGTTTCCGTCCTCAAGTCTACTTCG
CATATCTCTTCGACATCCAGTTCAAATGAGAATAGGATTGAGATAGAACAGGATTTGATCCCTAGAGGTGCTTCG
GTAGTGGTTGTGGATGATGTGCTCTCCACGGGGAATACACTCTGTGCGGTGCTACAGCTCCTAGGTGAAGTTGGC
ATCGCTGATGTCAGCGTTATGGTCGTGGCTGAGTTCCCTGTTCATCGCGGTCGGGAAGGGTTGCGCCAGCGTGGA
TTTGGCGTCAATGTCCAAAGCCTTTTGGTGTTTGACGGCGCCTAG
Gene >Pro_DTO377G3_2|g5494.t1
ATGGCCACTCTCGAATCTCTCAAGTGTGCTCTTAGGCAAAAGGCCACCGCAACGGGGTCATCCCCGAATCAGCCA
TTATCAGACATCCAGTACAACGCTGGCCTCGATATCTTACTGCAGGGTCCAACATACCAAGACTTCATCATCCCT
CAGATCTCTCGGCTGCTCGCTCCTCTCTTGGACTCGAATATCCAGATATCGGTGCTAGAAATAGGACCCGGCTCA
AAGAGCGTATTTGGATATCTGTCTGGTCGTCTGAGGCGGAAAATCAGGAAATACACTGCATTCGAGCCCAATGGC
CTGCTTGCTACAGGGTTGGAAAAATGGCTTTGCTCGAAATCAGAGGCAGAGTCCCCGCTGCCCTGTCTGGAAAGC
TCGCCTGATGTCCAGCGAATTCTATTCGGTGTAGAGAGCGACACGAATAGTACTGATACGCGTGACAAGGACGAA
AAGTTTGATGTTATCCTATCTTGTCACGGCATGCATGACATGATGCCAAAAACCAGGTTCATCGGACAAGCGCTA
GAAATGCTGGTTAAGCAACCCGAAGGAGGAATGGTGGTGATTTTTCATCGCGACTTGACCCTACACCTCGACGGA
TTAGCGTGCCATCGTACCGCTTGTTTTCCTATGGGAGCTGTTCGCGTGGCTAATAGTGATGAGATACTGGATTCT
TTTGCTCCTTTCATCGCAGGGTTTGCCATGCGGGATGTGGAGGCGGACAAGGATACCCGAATTGAATGGCGTGAG
GTGTGCCGCGCCTTGGGCCGCTCGGAGGCTCACCCAGACCATCTATTATTCAGCTCGCCCAATATCATGTCGGCC
TTCACCCACCATGCGACCGCATTGCCGGAGCTGACAGCACAGGTGCCATTGTTGGAAGGAGGCAAAGCTGTTAAG
AACCGAGAGGCTCGTCTTCACCACCCCGCCTCGACTGTTAGGCCGACAGAGGTACGACAAATTCAGCAGTGTGTT
AAATGGGCTCTGAAGCACGGTGCTAATTTGACCGTCGTTGGCGGGGGTCACAGCGGCCACTGCCTATGTCCCAAC
GTCGTTTCGGTCGACATGAGCGCCTTTGAACAAGTGCATATTATCACAGCCGAGGATAGTGGACTAGAATCTGGT
CTTGATTCTGTTCCCTTGGTTGTCGCCGAGGCGGGCTGCAAGGTAGGGGATATTGTCCGCAAGACCATGGCAGCC
GGCATGACAGTGCCCTTAGGGGCCCGCCCAAGTGTAGGCGCGGGGCTATGGCTACAAGGCGGCATCGGGCACCTG
GCTAGGATATATGGGCTCGCGTGTGACGCCATCGTCGGTGCCGTGATGGTCAGCGTCGACTCTAGCCAAGCCTTT
TGCATCGGCCGTGTACCAAGCCAACACTGGCCGGCCGGTGCCGTGCGCCCAGAAAACGAAGCCGATCTGTTATGG
GCGATAAAAGGCGCTGGAACCAACTTCGGTATCGTAGTCAGCGTTACTTTCCAGGCTTACGCGGCTCCGATGTTC
TCGATTCGAAATTGGGTTGTCCCGCTGAGTGACAATCTCGAAGCGCAGGGCAGGCTCAGCAATTTTGATAAATTA
GTCGCGAGGCTTCCTCGGAACTATTCTATGGACGCATATCTGTATTGGGACCTCGGAAAGTTGCATCTTGGCGTG
ACCATGTTTGAATCTTCCACGAACGGGCGCACCTCTGGAACATCCATCTCCACGCCCACGCCAGCAGCAACACTT
TTCGAGCGGGAAGACAAATTTCAAGTCGTGGACTGCGTCGGCTTGTTTGACGCCGATATGTACATGTCCGGAATG
CACAGTGGGCAGACCAGCACCAATACATCAGCATTCAAGCGATGTTTATTCTTAAAAAGTATTGGCGTAATGAAT
GTCGCCAAAATATTGCTGGCAGCCGTTGAGACTCGCCCCACGCCACTGTGCTATCTCCATCTGCTACAAGGTGGC
GGAGCTATCAGTGACGTGGCGGCCGATGCGACTGCTTTCGGTTGTCGAGACTGGGACTTTGCCTGCGTGATCACT
GGCGTCTGGCCACGCGACCAAGATGGAACCGAAGTCGCACAAGCCGCCGTACGGTGGGTATATAAGGTCGCTAGC
GACTTGTTGCCCACGAGTAGCGGAGTTTACGGCGCAGACCTGGGGCCGGACCCTAGAGACGCCGCGCTGGCGGCC
AAGGCTTTTGGATCGAACCGGCCACGCCTGGCTCGCCTCAAGCGCAGCTCGGATCCGCATAATGTGCTAGCTTAC
ACCTGCCCGCTTCCTAAAGCGCCCATAGAACATAAGCTTGTCATTCTAGTCACAGGTGTAAGCGGCGCCGGTAAG
GATTATTGCGCCGACATCTGGGTCTCGGTATTCCTTGAACACACCCAGAAAATGATTATGGCGCGCGCAGTCAGC
ATTAGCGATGCGACCAAGCGAGAATACGCGGCGGCCACTGGTGCCGACTTCAACCGCCTGCTTCAAGACCGTGGC
TATAAAGAGGAACATCGGCCAGCGTTGACAGCGTTCTTCCAGAACCAAGTGCGACATCGACCTCGGTTGCCAGAG
GAGCATTTTCTAAATGTGGTAAACGGTGCCGGAGACGTACATGTGCTGCTAATCACCGGAATGAGAGATGAGGCG
CCAGTTGCAGCCTTCTCGCCTTTGGTGCCAGGCAGCAGACTGCTCGAGGTCCGGGTGAACAGTAGCAAAGCGGCA
CGGCTTGCCCGCCGAGGCTGCCATGGCGGTGATTCTGATCATGGTGACAAAGAGAATGGCAGCCGCCCTGGCCTC
GTCTTCAATAATGACGCGACCGGAAACGACGCGGCCAGAAGGTTTGCCGAAGAATACCTGATTCGCTTCATCGAT
GGAGACCTCCAGCGACTAGCCAACATGGTGCGTCCAGTACCTGACTTTCCACGCCCGGGCGTTGAATTCCGCCAT
GTGCTCAACATCTGCCAGCAGCCGGGTGGGCTAGCCCTGTGCACCTCTCTGCTACAGACTCACTTCACTGGTGAA
TGGGCCAAGGTTGACGTGATAGTGAGTTGTGAGACCGGCGGCTTCATCTATGCGTCGGCGTTGGCCTCGCGGGTT
GATGTGCCTTTGGTGCTGATTCGGGAAGCAGGGAAACTGCCGCCACCCACCGTTTCCGTCCTCAAGTCTACTTCG
CATATCTCTTCGACATCCAGTTCAAATGAGAATAGGATTGAGATAGAACAGGATTTGATCCCTAGAGGTGCTTCG
GTAGTGGTTGTGGATGATGTGCTCTCCACGGGGAATACACTCTGTGCGGTGCTACAGCTCCTAGGTGAAGTTGGC
ATCGCTGATGTCAGCGTTATGGTCGTGGCTGAGTTCCCTGTTCATCGCGGTCGGGAAGGGTTGCGCCAGCGTGGA
TTTGGCGTCAATGTCCAAAGCCTTTTGGTGTTTGACGGCGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail