Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5491.t1
Gene name
Locationscaffold_13:258417..262924
Strand+
Gene length (bp)4507
Transcript length (bp)3387
Coding sequence length (bp)3387
Protein length (aa) 1129

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 1.5E-38 19 383

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 19.68 11.76 27.61
5d_25C Five days - 25 degrees Celsius 18.74 11.06 26.42
7d_25C Seven days - 25 degrees Celsius 19.54 11.65 27.42
10d_25C Ten days - 25 degrees Celsius 27.42 16.64 38.19
7d_15C Seven days - 15 degrees Celsius 31.55 19.19 43.91
7d_30C Seven days - 30 degrees Celsius 38.12 23.15 53.09

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.883320 no
3d_25C 7d_25C 0.983774 no
3d_25C 7d_15C 0.026342 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.142370 no
5d_25C 7d_25C 0.906151 no
5d_25C 7d_15C 0.014096 yes
5d_25C 7d_30C 0.000700 yes
5d_25C 10d_25C 0.083951 no
7d_25C 7d_15C 0.022435 yes
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 0.130081 no
7d_15C 7d_30C 0.457177 no
7d_15C 10d_25C 0.608794 no
7d_30C 10d_25C 0.144613 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5491.t1
MSLNAQVQSHLRDIVDKACEDQKSGIPGTTVVVVGKDGNELFAHSAGKRGAGSEDPMTLDTIFWIASCTKVVVGL
ACMQLVEQGILKLDDAEQTEGLCPELKSLKVLLPDGSFEEKKNGITLRMLLSHTAGFGYTFFNERLRQWSYPIGA
DEFSGRIEDMKMPLLFQPGEGWQYGVGIDWAGIALERATGLTLNEYLQKNIFLPLGIKNMSMIPSHDMRQKLAYM
NQRNPDGTLRPRDHPLRAPLVVDLENKAEVARVFNSGGAGIFAKPQDYCKVLAVLLNDGTCPKTGSKLLRKETVD
EMFSNQIPQFPNYSRQSIPDAKPDLTNPVPELYPVAGNPPQGWGLTFMLSNGGPTGRSTSTGHWAGLPNLWWWAD
REKGVAGIIETGPGTWSNLLDPNYTREVMDWDSESANVDLSGSLVDCTSTLFSSMLNEPETSQENVQAEIPDALM
PARSVSDLIPPYFPISPNTSMQPPSDLELDPMYQQMWLASQASQTYSSLGSAPSQSPRRPSDSAWMSANQQSSDW
PSPQSSLSPFSIDQQMINTSNSHLTSVNLLQIYHDVLEHNLSCWLSDMTCPYQLGSRNTPQLVPELGYSRSNMIY
QRTIRLDRVAQSSNLLQLTRAEDQAASKALHLAIMAFATQWAQGSYRHREKYPTRCLDGGEDEIANGVADEFDRI
LQNHFWEQAQRALQQVAGLESYRVTWAELIFGFTQRPWNPDTRPSRQRMQEQGSEFATESVLTKLHDIIHKDGPP
VYMERAARKMHALKFRCDVLEKGLGKPYGSRKKGTHGIEAMSAEERGTIGLLYWMAIMCDTLSSSINERPVVVLD
QDCEHERQKEIQQAGNIDKSIGRSRWNLDIFLQGNLKQMRRTHWPCSYEAAAEDVIKSAPVKVLLFRHLSYLQNA
VRKSVPEEQIEDIVRMAMLLYEYWNRTHGAFFDELVQNYHAVPQRIRGWFLCISAHWNLAALMFADLLEFIDENS
LGVDGATRITGQVARRIRMHSARELSILARVGTPSTRNSDNLCVPQMSDFHHAVKESTLLTEPWTIVLIRAFTKA
SMVFLGEADESLRYDGIILGQSSHDFEGNMEQAEDCMKGLWLLGKKSDMAREIAEILSLALRELRKSKVAALLPV
GLS*
Coding >Pro_DTO377G3_2|g5491.t1
ATGTCTCTAAATGCACAGGTGCAATCGCATCTCCGCGATATTGTAGACAAAGCTTGTGAAGACCAAAAGTCCGGC
ATTCCTGGGACTACGGTCGTGGTCGTTGGCAAAGATGGCAACGAACTTTTCGCTCACTCCGCGGGTAAGCGAGGC
GCGGGATCCGAAGACCCTATGACCCTCGATACCATTTTCTGGATTGCATCTTGTACTAAGGTGGTGGTTGGTCTT
GCTTGCATGCAACTGGTTGAGCAAGGAATTCTCAAGCTGGATGATGCGGAGCAGACAGAGGGTCTTTGCCCTGAA
TTGAAGAGTCTCAAGGTTCTGCTGCCAGACGGTAGTTTTGAGGAAAAGAAGAATGGGATCACCCTGCGCATGCTC
TTATCTCATACTGCTGGATTCGGCTATACCTTTTTCAATGAGAGACTGAGACAGTGGTCGTACCCGATCGGCGCG
GATGAGTTCTCTGGGCGGATTGAAGATATGAAGATGCCTCTGCTATTCCAGCCCGGTGAAGGTTGGCAATATGGT
GTTGGTATCGACTGGGCGGGAATCGCACTGGAACGCGCAACTGGCCTGACGCTCAACGAATACCTACAAAAGAAC
ATCTTCCTGCCCCTTGGAATTAAGAACATGTCCATGATCCCAAGCCATGACATGCGTCAGAAGCTGGCATACATG
AATCAACGAAACCCAGATGGGACTCTGAGGCCCCGAGACCATCCTCTTCGGGCGCCTCTAGTGGTTGATCTGGAG
AACAAGGCTGAAGTCGCCAGGGTGTTCAATAGTGGTGGTGCGGGTATATTTGCAAAGCCACAGGATTACTGCAAG
GTCCTCGCTGTGCTGTTGAATGATGGAACGTGCCCTAAAACGGGCAGCAAGTTGCTTCGCAAGGAGACCGTCGAC
GAAATGTTCTCTAACCAGATCCCTCAGTTCCCCAACTACAGCCGTCAAAGCATCCCAGATGCAAAGCCGGACCTG
ACCAACCCCGTTCCTGAACTGTACCCAGTTGCTGGGAACCCACCACAGGGTTGGGGCCTCACTTTCATGCTGAGC
AACGGCGGTCCAACAGGGCGGTCGACTAGCACAGGGCACTGGGCTGGGCTCCCGAATTTGTGGTGGTGGGCGGAC
AGGGAGAAGGGAGTTGCGGGGATTATTGAAACCGGACCTGGAACATGGAGCAATTTACTCGATCCAAATTATACG
CGGGAGGTTATGGATTGGGACTCGGAGTCAGCAAACGTGGATTTGTCTGGGTCGTTGGTCGATTGTACTTCAACG
CTGTTCAGTTCCATGCTCAACGAGCCCGAGACCTCCCAGGAAAATGTTCAGGCGGAGATTCCTGACGCATTGATG
CCTGCACGGTCTGTGTCTGATCTCATTCCACCATACTTCCCTATTTCCCCAAACACCTCCATGCAACCACCCTCG
GATCTCGAACTTGATCCAATGTATCAACAGATGTGGCTGGCCTCCCAGGCTTCTCAGACATATAGTAGCCTCGGA
TCCGCCCCATCCCAAAGCCCGCGGCGACCGAGTGACTCCGCTTGGATGTCTGCCAACCAGCAATCCTCCGACTGG
CCCAGCCCGCAAAGCTCACTCTCTCCGTTTTCCATCGACCAACAAATGATTAACACATCCAACTCCCATTTAACT
TCAGTCAACCTGCTGCAAATATATCACGATGTGCTAGAGCATAACCTGTCGTGTTGGCTAAGCGATATGACTTGT
CCCTACCAACTTGGCTCACGAAATACCCCTCAGCTTGTACCCGAATTGGGATATTCACGGTCTAATATGATATAC
CAGCGCACGATCAGGCTCGATCGCGTCGCACAATCTTCCAATCTTCTCCAGCTGACACGCGCCGAGGACCAGGCC
GCCTCCAAAGCTTTGCACCTTGCAATCATGGCATTTGCTACGCAGTGGGCACAGGGCAGTTACCGACACCGCGAG
AAATATCCGACCAGGTGTCTCGACGGTGGAGAGGACGAAATCGCCAATGGCGTCGCCGACGAGTTCGATCGCATT
CTTCAGAACCACTTTTGGGAGCAGGCGCAGCGCGCGCTCCAACAAGTCGCCGGTTTGGAGTCGTATAGAGTTACA
TGGGCCGAGCTGATCTTCGGCTTCACACAAAGGCCGTGGAATCCCGACACTCGGCCTTCTAGACAGCGGATGCAA
GAACAAGGCTCCGAGTTTGCCACCGAATCCGTCTTGACAAAGTTACACGATATAATACACAAAGATGGACCACCA
GTATACATGGAGAGAGCAGCTCGGAAAATGCACGCCTTGAAATTTCGCTGCGACGTGCTCGAAAAGGGCCTCGGC
AAGCCGTACGGCAGTCGCAAGAAAGGGACCCATGGCATTGAAGCCATGAGTGCGGAAGAGCGAGGGACAATTGGC
CTGCTCTACTGGATGGCTATCATGTGTGACACCCTCTCGTCGTCTATAAACGAACGACCCGTCGTGGTGCTGGAT
CAGGACTGCGAGCACGAACGGCAAAAAGAGATCCAGCAAGCAGGGAATATCGACAAATCTATCGGAAGAAGTCGA
TGGAATCTCGATATCTTTTTGCAAGGAAACCTCAAGCAGATGCGCCGAACGCACTGGCCCTGTTCCTATGAGGCT
GCAGCTGAAGACGTGATCAAGTCAGCGCCAGTCAAGGTTCTTCTATTCCGCCACCTGTCTTACCTACAAAACGCG
GTTCGCAAGAGTGTTCCTGAAGAGCAGATCGAGGACATTGTCCGCATGGCGATGTTGTTATATGAATACTGGAAT
AGAACGCATGGCGCCTTCTTCGATGAACTAGTGCAGAACTACCATGCGGTTCCGCAGCGCATACGGGGCTGGTTC
CTCTGTATCTCTGCGCACTGGAACCTTGCTGCTCTTATGTTTGCCGACCTGCTAGAATTTATCGACGAGAATTCC
CTAGGCGTGGATGGTGCAACTCGTATCACCGGTCAAGTGGCGAGGAGAATTAGGATGCACAGCGCCAGGGAACTA
TCAATTCTGGCAAGGGTCGGTACGCCGTCTACCAGAAATAGTGATAACCTTTGTGTGCCGCAGATGTCAGACTTC
CACCACGCTGTCAAGGAGAGCACGCTTTTGACCGAGCCATGGACGATAGTTTTAATCAGAGCATTTACCAAAGCT
TCTATGGTCTTTCTAGGTGAAGCAGATGAGTCCTTGCGGTACGACGGAATTATTCTCGGGCAGAGCAGTCATGAT
TTCGAGGGGAATATGGAGCAGGCCGAGGATTGTATGAAGGGGCTGTGGCTACTAGGTAAAAAGTCGGATATGGCA
CGGGAGATTGCCGAGATCCTTTCACTAGCGTTGAGAGAATTGCGGAAGAGTAAGGTGGCCGCTCTTTTACCGGTT
GGGTTGTCATAG
Transcript >Pro_DTO377G3_2|g5491.t1
ATGTCTCTAAATGCACAGGTGCAATCGCATCTCCGCGATATTGTAGACAAAGCTTGTGAAGACCAAAAGTCCGGC
ATTCCTGGGACTACGGTCGTGGTCGTTGGCAAAGATGGCAACGAACTTTTCGCTCACTCCGCGGGTAAGCGAGGC
GCGGGATCCGAAGACCCTATGACCCTCGATACCATTTTCTGGATTGCATCTTGTACTAAGGTGGTGGTTGGTCTT
GCTTGCATGCAACTGGTTGAGCAAGGAATTCTCAAGCTGGATGATGCGGAGCAGACAGAGGGTCTTTGCCCTGAA
TTGAAGAGTCTCAAGGTTCTGCTGCCAGACGGTAGTTTTGAGGAAAAGAAGAATGGGATCACCCTGCGCATGCTC
TTATCTCATACTGCTGGATTCGGCTATACCTTTTTCAATGAGAGACTGAGACAGTGGTCGTACCCGATCGGCGCG
GATGAGTTCTCTGGGCGGATTGAAGATATGAAGATGCCTCTGCTATTCCAGCCCGGTGAAGGTTGGCAATATGGT
GTTGGTATCGACTGGGCGGGAATCGCACTGGAACGCGCAACTGGCCTGACGCTCAACGAATACCTACAAAAGAAC
ATCTTCCTGCCCCTTGGAATTAAGAACATGTCCATGATCCCAAGCCATGACATGCGTCAGAAGCTGGCATACATG
AATCAACGAAACCCAGATGGGACTCTGAGGCCCCGAGACCATCCTCTTCGGGCGCCTCTAGTGGTTGATCTGGAG
AACAAGGCTGAAGTCGCCAGGGTGTTCAATAGTGGTGGTGCGGGTATATTTGCAAAGCCACAGGATTACTGCAAG
GTCCTCGCTGTGCTGTTGAATGATGGAACGTGCCCTAAAACGGGCAGCAAGTTGCTTCGCAAGGAGACCGTCGAC
GAAATGTTCTCTAACCAGATCCCTCAGTTCCCCAACTACAGCCGTCAAAGCATCCCAGATGCAAAGCCGGACCTG
ACCAACCCCGTTCCTGAACTGTACCCAGTTGCTGGGAACCCACCACAGGGTTGGGGCCTCACTTTCATGCTGAGC
AACGGCGGTCCAACAGGGCGGTCGACTAGCACAGGGCACTGGGCTGGGCTCCCGAATTTGTGGTGGTGGGCGGAC
AGGGAGAAGGGAGTTGCGGGGATTATTGAAACCGGACCTGGAACATGGAGCAATTTACTCGATCCAAATTATACG
CGGGAGGTTATGGATTGGGACTCGGAGTCAGCAAACGTGGATTTGTCTGGGTCGTTGGTCGATTGTACTTCAACG
CTGTTCAGTTCCATGCTCAACGAGCCCGAGACCTCCCAGGAAAATGTTCAGGCGGAGATTCCTGACGCATTGATG
CCTGCACGGTCTGTGTCTGATCTCATTCCACCATACTTCCCTATTTCCCCAAACACCTCCATGCAACCACCCTCG
GATCTCGAACTTGATCCAATGTATCAACAGATGTGGCTGGCCTCCCAGGCTTCTCAGACATATAGTAGCCTCGGA
TCCGCCCCATCCCAAAGCCCGCGGCGACCGAGTGACTCCGCTTGGATGTCTGCCAACCAGCAATCCTCCGACTGG
CCCAGCCCGCAAAGCTCACTCTCTCCGTTTTCCATCGACCAACAAATGATTAACACATCCAACTCCCATTTAACT
TCAGTCAACCTGCTGCAAATATATCACGATGTGCTAGAGCATAACCTGTCGTGTTGGCTAAGCGATATGACTTGT
CCCTACCAACTTGGCTCACGAAATACCCCTCAGCTTGTACCCGAATTGGGATATTCACGGTCTAATATGATATAC
CAGCGCACGATCAGGCTCGATCGCGTCGCACAATCTTCCAATCTTCTCCAGCTGACACGCGCCGAGGACCAGGCC
GCCTCCAAAGCTTTGCACCTTGCAATCATGGCATTTGCTACGCAGTGGGCACAGGGCAGTTACCGACACCGCGAG
AAATATCCGACCAGGTGTCTCGACGGTGGAGAGGACGAAATCGCCAATGGCGTCGCCGACGAGTTCGATCGCATT
CTTCAGAACCACTTTTGGGAGCAGGCGCAGCGCGCGCTCCAACAAGTCGCCGGTTTGGAGTCGTATAGAGTTACA
TGGGCCGAGCTGATCTTCGGCTTCACACAAAGGCCGTGGAATCCCGACACTCGGCCTTCTAGACAGCGGATGCAA
GAACAAGGCTCCGAGTTTGCCACCGAATCCGTCTTGACAAAGTTACACGATATAATACACAAAGATGGACCACCA
GTATACATGGAGAGAGCAGCTCGGAAAATGCACGCCTTGAAATTTCGCTGCGACGTGCTCGAAAAGGGCCTCGGC
AAGCCGTACGGCAGTCGCAAGAAAGGGACCCATGGCATTGAAGCCATGAGTGCGGAAGAGCGAGGGACAATTGGC
CTGCTCTACTGGATGGCTATCATGTGTGACACCCTCTCGTCGTCTATAAACGAACGACCCGTCGTGGTGCTGGAT
CAGGACTGCGAGCACGAACGGCAAAAAGAGATCCAGCAAGCAGGGAATATCGACAAATCTATCGGAAGAAGTCGA
TGGAATCTCGATATCTTTTTGCAAGGAAACCTCAAGCAGATGCGCCGAACGCACTGGCCCTGTTCCTATGAGGCT
GCAGCTGAAGACGTGATCAAGTCAGCGCCAGTCAAGGTTCTTCTATTCCGCCACCTGTCTTACCTACAAAACGCG
GTTCGCAAGAGTGTTCCTGAAGAGCAGATCGAGGACATTGTCCGCATGGCGATGTTGTTATATGAATACTGGAAT
AGAACGCATGGCGCCTTCTTCGATGAACTAGTGCAGAACTACCATGCGGTTCCGCAGCGCATACGGGGCTGGTTC
CTCTGTATCTCTGCGCACTGGAACCTTGCTGCTCTTATGTTTGCCGACCTGCTAGAATTTATCGACGAGAATTCC
CTAGGCGTGGATGGTGCAACTCGTATCACCGGTCAAGTGGCGAGGAGAATTAGGATGCACAGCGCCAGGGAACTA
TCAATTCTGGCAAGGGTCGGTACGCCGTCTACCAGAAATAGTGATAACCTTTGTGTGCCGCAGATGTCAGACTTC
CACCACGCTGTCAAGGAGAGCACGCTTTTGACCGAGCCATGGACGATAGTTTTAATCAGAGCATTTACCAAAGCT
TCTATGGTCTTTCTAGGTGAAGCAGATGAGTCCTTGCGGTACGACGGAATTATTCTCGGGCAGAGCAGTCATGAT
TTCGAGGGGAATATGGAGCAGGCCGAGGATTGTATGAAGGGGCTGTGGCTACTAGGTAAAAAGTCGGATATGGCA
CGGGAGATTGCCGAGATCCTTTCACTAGCGTTGAGAGAATTGCGGAAGAGTAAGGTGGCCGCTCTTTTACCGGTT
GGGTTGTCATAG
Gene >Pro_DTO377G3_2|g5491.t1
ATGTCTCTAAATGCACAGGTGCAATCGCATCTCCGCGATATTGTAGACAAAGCTTGTGAAGACCAAAAGTCCGGC
ATTCCTGGGACTACGGTCGTGGTCGTTGGCAAAGATGGCAACGAACTTTTCGCTCACTCCGCGGGTAAGCGAGGC
GCGGGATCCGAAGACCCTATGACCCTCGATACCATTTTCTGGATTGCATCTTGTACTAAGGTGGTGGTTGGTCTT
GCTTGCATGCAACTGGTTGAGCAAGGAATTCTCAAGCTGGATGATGCGGAGCAGACAGAGGGTCTTTGCCCTGAA
TTGAAGAGTCTCAAGGTTCTGCTGCCAGACGGTAGTTTTGAGGAAAAGAAGAATGGGATCACCCTGCGCATGCTC
TTATCTCATACTGCTGGATTCGGCTATACCTTTTTCAATGAGAGACTGAGACAGTGGTCGTACCCGATCGGCGCG
GATGAGTTCTCTGGGCGGATTGAAGATATGAAGATGCCTCTGCTATTCCAGCCCGGTGAAGGTTGGCAATATGGT
GTAAGTATGATCTTTCGGAATCACGAAACGCATTGCTAATGAGTACAGGTTGGTATCGACTGGGCGGGAATCGCA
CTGGAACGCGCAACTGGCCTGACGCTCAACGAATACCTACAAAAGAACATCTTCCTGCCCCTTGGAATTAAGAAC
ATGTCCATGATCCCAAGCCATGACATGCGTCAGAAGCTGGCATACATGAATCAACGAAACCCAGATGGGACTCTG
AGGCCCCGAGACCATCCTCTTCGGGCGCCTCTAGTGGTTGATCTGGAGAACAAGGCTGAAGTCGCCAGGGTGTTC
AATAGTGGTGGTGCGGGTATATTTGCAAAGCCACAGGATTACTGCAGTAAGTCGCGGGTAGCTTCGATCCCAAGA
AACCACACACTAACTTATCTCCGCAGAGGTCCTCGCTGTGCTGTTGAATGATGGAACGTGCCCTAAAACGGGCAG
CAAGTTGCTTCGCAAGGAGACCGTCGACGAAATGTTCTCTAACCAGATCCCTCAGTTCCCCAACTACAGCCGTCA
AAGCATCCCAGATGCAAAGCCGGACCTGACCAACCCCGTTCCTGAACTGTACCCAGTTGCTGGGAACCCACCACA
GGGTTGGGGCCTCACTTTCATGCTGAGCAACGGCGGTCCAACAGGGCGGTCGACTAGCACAGGGCACTGGGCTGG
GCTCCCGAATTTGTGGTGGTGGGCGGACAGGGAGAAGGGAGTTGCGGGGATTGTTTGTACACAGATTCTGCCATT
TGTGGACCTTAATGTGCTTGGGCTATGGGGAACAGTTGAGGCTGAGATATACAAAGCCCTCGGTAAGGCTTGATG
TGGGAGACATTGTTTTTTATTTACCAGCCTTCACATGTTTCAGGAGGGATACAGGTAATTTACCCAGAGGTCATG
TGACCGGGATGTTCTGAAGATGTTCACCGGTGTATATTTGTAATTAGTCAGCATGTCACGGGTCCAGTTGAAATT
CTCCATTTTGTCAGCCGCTGATTGGTGCATATTAATTTAATTCCTATCAGATTCAGCTAGCCCGAGTTGTGGAGA
GTAATATATTTTCCTTCTCCTCTCCTATGTGTCATTTACTTGCAAAAATTCCTGTAGTCAACCCATGAGTTATTC
TCATCACTTTCAGATAAAAACAGACAATACCATTCAGCATTCATGGATGTACGGCGGACTAAGGGAAATCCGGGG
AATGCGGGGTCGAACGCCCCAGAAAATAGAAAAAAACCCTAAATATGAAGATCCGTTGCAATGCAGGTTTACGTG
GTTCGTTCCCCGCTTTTTGACGACATCTCAGATTCTCACAGCCCCTGGGCAAAACGAGAAAGAAGGAATAGAAAT
CAACCACAGCGGTCGATATGTCCGTCCAGAAACGAAGCACGACACTTGCACAAGGATCCAGATCCAGGCGTCAGT
ACCGCTCTTGCGACCAATGCAGAAAATCCAAGCGAGCATGCGATGCACCATGCCTGGATCCGACTAGACGAACAG
TGGTTAACAATTTTGACGGCCAGCGATCACCTTGTTCCTACTGTGTCAGAACAAATAAACGCTGTACTATGGAAT
GGGCCCGATCACAGACTCAGTCTGCGCTGAGAACGCCTCGCCAATCTCATTCTGGGTATGGGAGTCGAGATCTTC
TCTTCCCATGGAAATCAAATGAGCTCCAGATTGAAACCGGACCTGGAACATGGAGCAATTTACTCGATCCAAATT
ATACGCGGGAGGTTATGGATTGGGACTCGGAGTCAGCAAACGTGGATTTGTCTGGGTCGTTGGTCGATTGTACTT
CAACGCTGTTCAGTTCCATGCTCAACGAGCCCGAGACCTCCCAGGAAAATGTTCAGGCGGAGATTCCTGACGCAT
TGATGCCTGCACGGTCTGTGTCTGATCTCATTCCACCATACTTCCCTATTTCCCCAAACACCTCCATGCAACCAC
CCTCGGATCTCGAACTTGATCCAATGTATCAACAGATGTGGCTGGCCTCCCAGGCTTCTCAGACATATAGTAGCC
TCGGATCCGCCCCATCCCAAAGCCCGCGGCGACCGAGTGACTCCGCTTGGATGTCTGCCAACCAGCAATCCTCCG
ACTGGCCCAGCCCGCAAAGCTCACTCTCTCCGTTTTCCATCGACCAACAAATGATTAACACATCCAACTCCCATT
TAACTTCAGTCAACCTGCTGCAAATATATCACGATGTGCTAGAGCATAACCTGTCGTGTTGGCTAAGCGATATGA
CTTGTCCCTACCAACTTGGCTCACGAAATACCCCTCAGCTTGTACCCGAATTGGGATATTCACGGTCTAATATGA
TATACCAGCGCACGATCAGGCTCGATCGCGTCGCACAATCTTCCAATCTTCTCCAGCTGACACGCGCCGAGGACC
AGGCCGCCTCCAAAGCTTTGCACCTTGCAATCATGGCATTTGCTACGCAGTGGGCACAGGGCAGTTACCGACACC
GCGAGAAATATCCGACCAGGTGTCTCGACGGTGGAGAGGACGAAATCGCCAATGGCGTCGCCGACGAGTTCGATC
GCATTCTTCAGAACCACTTTTGGGAGCAGGCGCAGCGCGCGCTCCAACAAGTCGCCGGTTTGGAGTCGTATAGAG
TTACATGGGCCGAGCTGATCTTCGGCTTCACACAAAGGCCGTGGAATCCCGACACTCGGCCTTCTAGACAGCGGA
TGCAAGAACAAGGCTCCGAGTTTGCCACCGAATCCGTCTTGACAAAGTTACACGATATAATACACAAAGATGGAC
CACCAGTATACATGGAGAGAGCAGCTCGGAAAATGCACGCCTTGAAATTTCGCTGCGACGTGCTCGAAAAGGGCC
TCGGCAAGCCGTACGGCAGTCGCAAGAAAGGGACCCATGGCATTGAAGCCATGAGTGCGGAAGAGCGAGGGACAA
TTGGCCTGCTCTACTGGATGGCTATCATGTGTGACACCCTCTCGTCGTCTATAAACGAACGACCCGTCGTGGTGC
TGGATCAGGACTGCGAGCACGAACGGCAAAAAGAGATCCAGCAAGCAGGGAATATCGACAAATCTATCGGAAGAA
GTCGATGGAATCTCGATATCTTTTTGCAAGGAAACCTCAAGCAGATGCGCCGAACGCACTGGCCCTGTTCCTATG
AGGCTGCAGCTGAAGACGTGATCAAGTCAGCGCCAGTCAAGGTTCTTCTATTCCGCCACCTGTCTTACCTACAAA
ACGCGGTTCGCAAGAGTGTTCCTGAAGAGCAGATCGAGGACATTGTCCGCATGGCGATGTTGTTATATGAATACT
GGAATAGAACGCATGGCGCCTTCTTCGATGAACTAGTGCAGAACTACCATGCGGTTCCGCAGCGCATACGGGGCT
GGTTCCTCTGTATCTCTGCGCACTGGAACCTTGCTGCTCTTATGTTTGCCGACCTGCTAGAATTTATCGACGAGA
ATTCCCTAGGCGTGGATGGTGCAACTCGTATCACCGGTCAAGTGGCGAGGAGAATTAGGATGCACAGCGCCAGGG
AACTATCAATTCTGGCAAGGGTCGGTACGCCGTCTACCAGAAATAGTGATAACCTTTGTGTGCCGCAGATGTCAG
ACTTCCACCACGCTGTCAAGGAGAGCACGCTTTTGACCGAGCCATGGACGATAGTTTTAATCAGAGCATTTACCA
AAGCTTCTATGGTCTTTCTAGGTGAAGCAGATGAGTCCTTGCGGTACGACGGAATTATTCTCGGGCAGAGCAGTC
ATGATTTCGAGGGGAATATGGAGCAGGCCGAGGATTGTATGAAGGGGCTGTGGCTACTAGGTAAAAAGTCGGATA
TGGCACGGGAGATTGCCGAGATCCTTTCACTAGCGTTGAGAGAATTGCGGAAGAGGTGTGTTATATAGCTTCCAC
AATTCTGCAATCAACTTCATATTCACTAATGGACGCATTTTACAGTAAGGTGGCCGCTCTTTTACCGGTTGGGTT
GTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail