Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5475.t1
Gene name
Locationscaffold_13:220483..221087
Strand-
Gene length (bp)604
Transcript length (bp)477
Coding sequence length (bp)477
Protein length (aa) 159

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01817 CM_2 Chorismate mutase type II 1.8E-12 73 148

GO

GO Term Description Terminal node
GO:0046417 chorismate metabolic process Yes
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0019752 carboxylic acid metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0043648 dicarboxylic acid metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5475.t1
MIFQVLLGFLTLSTAIGSTANANANANANCYGSNVISAPSADHRPVPWGTPSVHFSSLNGTLTTCCNTLDEIRTA
LDDIDDQILQLLNRRAAYVREATRFKSTRASVNVPSRNEAVLQQAEQQAVHIGVPLTIARAAMGAILNSSVPFEQ
CIFDAYTE*
Coding >Pro_DTO377G3_2|g5475.t1
ATGATTTTCCAGGTACTTTTGGGGTTTCTAACCCTTTCCACTGCTATTGGTTCAACAGCCAATGCCAATGCCAAT
GCCAATGCGAACTGCTATGGTTCCAATGTGATTTCAGCACCTTCAGCAGACCATCGCCCGGTGCCATGGGGCACT
CCGAGCGTCCATTTTTCGTCATTAAATGGCACGTTAACTACGTGCTGTAACACTTTGGATGAGATCCGAACCGCG
CTAGATGATATCGACGATCAAATACTTCAGCTCCTAAATCGGCGAGCCGCATACGTCCGTGAGGCAACTCGTTTC
AAATCCACCCGGGCTTCTGTGAACGTTCCCTCGCGCAATGAGGCCGTTCTCCAACAGGCAGAGCAGCAGGCAGTG
CATATCGGGGTACCACTGACGATTGCCCGGGCGGCCATGGGGGCCATTCTGAACTCCAGCGTGCCCTTTGAACAG
TGCATTTTCGATGCCTATACGGAGTAA
Transcript >Pro_DTO377G3_2|g5475.t1
ATGATTTTCCAGGTACTTTTGGGGTTTCTAACCCTTTCCACTGCTATTGGTTCAACAGCCAATGCCAATGCCAAT
GCCAATGCGAACTGCTATGGTTCCAATGTGATTTCAGCACCTTCAGCAGACCATCGCCCGGTGCCATGGGGCACT
CCGAGCGTCCATTTTTCGTCATTAAATGGCACGTTAACTACGTGCTGTAACACTTTGGATGAGATCCGAACCGCG
CTAGATGATATCGACGATCAAATACTTCAGCTCCTAAATCGGCGAGCCGCATACGTCCGTGAGGCAACTCGTTTC
AAATCCACCCGGGCTTCTGTGAACGTTCCCTCGCGCAATGAGGCCGTTCTCCAACAGGCAGAGCAGCAGGCAGTG
CATATCGGGGTACCACTGACGATTGCCCGGGCGGCCATGGGGGCCATTCTGAACTCCAGCGTGCCCTTTGAACAG
TGCATTTTCGATGCCTATACGGAGTAA
Gene >Pro_DTO377G3_2|g5475.t1
ATGATTTTCCAGGTACTTTTGGGGTTTCTAACCCTTTCCACTGCTATTGGTTCAACAGCCAATGCCAATGCCAAT
GCCAATGCGAACTGCTATGGTTCCAATGTGATTTCAGCACCTTCAGCAGACCATCGCCCGGTGCCATGGGGCACT
CCGAGCGTCCATTTTTCGTCATTAAATGGCACGTTAACTACGTGCTGTAACACTTTGGATGAGATCCGAACCGCG
CTAGATGATATCGACGATCAAATACTTCAGCTCCTAAATCGGCGGTTTGTACTCCGACCTCCGTCCCTGAGCAGG
ACTTGAAATGTTTATTTACGACTTTGACATTAACACATTAACTCTTATAGAGCCGCATACGTCCGTGAGGCAACT
CGTTTCAAATCCACCCGGGCTTCTGTGAACGTTCCCTCGCGCAATGAGGCCGTTCTCCAACAGGCAGAGCAGCAG
GCAGTGCATATCGGGGTACCACTGACGATTGCCCGGGCGGCCATGGGGGCCATTCTGAACTCCAGCGTGCCCTTT
GAACAGTGCATTGTAAGTGAGTCTGTATTCTCAATTAGATTTGAAACTGACTCTCAAGTTCGATGCCTATACGGA
GTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail