Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5468.t1
Gene name
Locationscaffold_13:198478..201168
Strand-
Gene length (bp)2690
Transcript length (bp)2628
Coding sequence length (bp)2628
Protein length (aa) 876

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17681 GCP_N_terminal Gamma tubulin complex component N-terminal 3.3E-34 236 518
PF04130 GCP_C_terminal Gamma tubulin complex component C-terminal 2.5E-22 608 850
PF14609 GCP5-Mod21 gamma-Tubulin ring complex non-core subunit mod21 2.9E-11 56 361

GO

GO Term Description Terminal node
GO:0043015 gamma-tubulin binding Yes
GO:0005515 protein binding No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No
GO:0015631 tubulin binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5468.t1
MALAADLSTLIDALITSVAKISPNHKGSARVQSLKRRVQGALRTGSHTRTDQFAVAKQLEGLQEKFQILNRDELA
EALHARLAELESDRMPWLPEILSLLLQLSDRPALLSTVKRPKERAKAPEAKETLSWSDLDAAGTAFSDEEIWEQV
DFAGDSSDDDFSSVASDVSLPKDRPQSATTVDEGYIIPDDVFVSEEDGDLVASIEKAQFWRAENHHSLPQAEATT
SRLITESQLARETIFMLQGLPTSIYVRLDDDFGVDRRYTLAHSSNEALASLLQCFIEIGAKLNAVRYFTKLPQTI
PYMQTFCRSLEERLLEFDRVLSQVQCKYLSPGSTVSLIQLLVDVRQHSHELALLADMIANLERNSNDQPMCCLDS
LYNLVCMLEALGDESSSQRLAELFFMCFKTYSSSIRLWMETGQVDASDSTFFVRTNRENGDLRTLWHDWFVLDTG
HRQQRIPQFLEAGVQKVFTAGKSMVFLRHLNALPDIEAMKFEDFYCQDSSLLLPFPALVESAFEKLVDVDHSLSA
SLLRTELDQQCGLWTSLDALQHVYLAKDMSAISIVDAKIFELIDRGRSWDDRFLLTEISRTAFSSISVIDVSRLL
VRPASTSLRVSQNDHRTVGILEAISIDYGLPWPIANIITEDAIQAYQRISTFLMQIRRAKYAIVKQRIRDARIIA
PDEKDTLVHALHHNMLWVLDLIYGHLTYLVITTTTQSLHKDLSGAQDVDAMIAAHQSYMSSLEAQCLLSEDLSHI
HDAIIHFLDLCVHFADLQTAHLLGDEDQYLENPKALRTKKKPEEEFESDDDEDDDDNEAYDHEHTLTVSFRDSTY
SQQLKTVNYQFNHLTTFVTDGLKSLVRADGLQSWDILADRLEWRRNWRRL*
Coding >Pro_DTO377G3_2|g5468.t1
ATGGCTCTAGCGGCTGATCTGAGTACGCTTATCGACGCCTTAATCACTTCTGTCGCTAAGATATCACCAAACCAC
AAGGGGTCTGCACGTGTCCAGAGTCTGAAGCGCCGTGTACAAGGAGCGCTCCGAACTGGTTCTCATACGCGCACC
GACCAGTTTGCAGTCGCCAAGCAACTCGAGGGACTACAGGAAAAGTTTCAAATCTTGAATAGAGATGAACTTGCT
GAAGCTCTTCACGCCCGCCTTGCGGAGCTGGAGAGCGACCGGATGCCCTGGCTTCCAGAGATTCTGAGTCTCTTA
TTGCAACTCTCAGATCGCCCCGCTCTTTTGTCAACGGTCAAACGTCCGAAGGAACGGGCCAAGGCACCAGAAGCA
AAAGAGACTCTTTCTTGGTCGGACCTTGATGCAGCTGGGACGGCATTCAGCGACGAAGAAATTTGGGAACAAGTA
GACTTTGCTGGCGACTCATCAGATGACGACTTTTCATCCGTTGCCAGTGATGTATCTCTTCCCAAGGACAGACCT
CAATCCGCCACAACAGTGGATGAAGGGTATATCATTCCAGATGACGTTTTTGTTTCGGAAGAGGATGGCGATCTT
GTTGCCTCTATAGAAAAGGCCCAATTTTGGAGAGCCGAGAATCACCATTCGTTGCCCCAAGCAGAAGCAACCACC
TCGCGACTTATCACAGAATCCCAGCTTGCTAGGGAGACAATCTTCATGCTTCAGGGCCTTCCCACGTCTATTTAC
GTGCGCTTGGACGATGATTTTGGAGTGGATCGAAGATACACACTCGCACATTCATCCAACGAAGCCCTGGCATCG
CTTTTGCAGTGTTTCATTGAGATAGGCGCCAAGCTCAACGCTGTACGGTATTTCACCAAGCTTCCACAGACCATC
CCATATATGCAAACGTTTTGCCGGAGCTTAGAAGAGCGTCTCCTTGAATTTGATAGAGTCTTATCTCAAGTTCAG
TGCAAATACCTTTCACCCGGTTCAACTGTCAGTCTCATCCAGCTTCTTGTTGATGTTCGTCAGCACTCTCATGAG
CTAGCATTGCTCGCAGACATGATCGCCAATTTAGAAAGAAACTCAAATGATCAACCAATGTGCTGCCTTGATTCC
TTATACAACTTAGTATGCATGCTGGAAGCCCTTGGCGACGAAAGTTCGTCTCAGCGCCTGGCGGAGCTATTTTTT
ATGTGTTTCAAAACATATTCAAGCTCGATCCGACTCTGGATGGAAACAGGTCAGGTCGATGCTTCGGACAGCACT
TTCTTCGTGCGAACAAATCGTGAGAATGGGGATCTGCGGACTCTTTGGCATGACTGGTTTGTGCTTGATACGGGC
CACAGGCAGCAGAGGATCCCCCAGTTTCTCGAGGCCGGTGTGCAGAAAGTCTTCACTGCAGGAAAGAGCATGGTA
TTTCTCCGCCATCTAAATGCGCTACCAGACATTGAAGCCATGAAATTTGAGGACTTCTATTGCCAGGATTCTTCA
TTATTACTTCCTTTCCCCGCATTAGTAGAGTCTGCTTTTGAAAAACTCGTGGATGTGGACCATTCACTCAGTGCT
AGCTTATTACGAACTGAACTCGACCAACAATGCGGACTATGGACCTCCCTTGATGCTCTTCAACATGTCTACCTT
GCCAAAGACATGAGCGCCATCAGCATTGTTGACGCAAAAATCTTTGAGTTGATCGATCGGGGTCGTTCCTGGGAC
GACAGATTCCTGCTCACTGAGATATCAAGGACAGCTTTCAGTTCAATATCCGTCATTGACGTATCAAGACTCCTT
GTGCGGCCTGCTAGTACTTCATTGCGAGTTTCTCAAAATGATCATCGGACCGTGGGAATTCTAGAAGCAATCTCA
ATTGATTATGGCCTCCCGTGGCCTATTGCGAACATAATCACCGAGGACGCAATACAGGCATACCAACGAATCTCG
ACCTTCCTGATGCAGATCAGGCGCGCTAAATATGCCATTGTGAAACAGCGTATTCGCGACGCCCGTATCATCGCA
CCTGACGAAAAGGACACATTGGTACACGCTCTACATCATAACATGCTCTGGGTCCTCGATCTCATCTACGGCCAT
CTGACCTATCTCGTAATAACCACCACAACCCAATCTCTACACAAAGATCTATCTGGCGCACAAGATGTCGATGCC
ATGATAGCTGCCCACCAATCCTACATGTCCTCTTTGGAAGCCCAGTGTCTTCTTTCTGAAGATTTATCACATATC
CACGATGCAATCATCCATTTCTTAGATCTGTGTGTTCATTTCGCAGATCTACAAACCGCGCACTTGCTCGGCGAT
GAAGACCAATATCTGGAGAATCCGAAGGCGCTGCGCACAAAGAAAAAACCCGAAGAAGAATTCGAGTCTGATGAT
GATGAAGATGATGATGATAACGAGGCCTACGATCACGAACACACACTCACAGTCTCATTTCGTGACTCGACCTAT
AGCCAGCAGCTGAAAACGGTCAATTACCAGTTCAACCATCTAACGACCTTTGTCACGGATGGCTTGAAAAGTTTA
GTTCGTGCAGATGGGCTGCAAAGTTGGGATATTCTTGCCGACAGGCTCGAATGGCGGCGAAATTGGCGTAGGCTT
TGA
Transcript >Pro_DTO377G3_2|g5468.t1
ATGGCTCTAGCGGCTGATCTGAGTACGCTTATCGACGCCTTAATCACTTCTGTCGCTAAGATATCACCAAACCAC
AAGGGGTCTGCACGTGTCCAGAGTCTGAAGCGCCGTGTACAAGGAGCGCTCCGAACTGGTTCTCATACGCGCACC
GACCAGTTTGCAGTCGCCAAGCAACTCGAGGGACTACAGGAAAAGTTTCAAATCTTGAATAGAGATGAACTTGCT
GAAGCTCTTCACGCCCGCCTTGCGGAGCTGGAGAGCGACCGGATGCCCTGGCTTCCAGAGATTCTGAGTCTCTTA
TTGCAACTCTCAGATCGCCCCGCTCTTTTGTCAACGGTCAAACGTCCGAAGGAACGGGCCAAGGCACCAGAAGCA
AAAGAGACTCTTTCTTGGTCGGACCTTGATGCAGCTGGGACGGCATTCAGCGACGAAGAAATTTGGGAACAAGTA
GACTTTGCTGGCGACTCATCAGATGACGACTTTTCATCCGTTGCCAGTGATGTATCTCTTCCCAAGGACAGACCT
CAATCCGCCACAACAGTGGATGAAGGGTATATCATTCCAGATGACGTTTTTGTTTCGGAAGAGGATGGCGATCTT
GTTGCCTCTATAGAAAAGGCCCAATTTTGGAGAGCCGAGAATCACCATTCGTTGCCCCAAGCAGAAGCAACCACC
TCGCGACTTATCACAGAATCCCAGCTTGCTAGGGAGACAATCTTCATGCTTCAGGGCCTTCCCACGTCTATTTAC
GTGCGCTTGGACGATGATTTTGGAGTGGATCGAAGATACACACTCGCACATTCATCCAACGAAGCCCTGGCATCG
CTTTTGCAGTGTTTCATTGAGATAGGCGCCAAGCTCAACGCTGTACGGTATTTCACCAAGCTTCCACAGACCATC
CCATATATGCAAACGTTTTGCCGGAGCTTAGAAGAGCGTCTCCTTGAATTTGATAGAGTCTTATCTCAAGTTCAG
TGCAAATACCTTTCACCCGGTTCAACTGTCAGTCTCATCCAGCTTCTTGTTGATGTTCGTCAGCACTCTCATGAG
CTAGCATTGCTCGCAGACATGATCGCCAATTTAGAAAGAAACTCAAATGATCAACCAATGTGCTGCCTTGATTCC
TTATACAACTTAGTATGCATGCTGGAAGCCCTTGGCGACGAAAGTTCGTCTCAGCGCCTGGCGGAGCTATTTTTT
ATGTGTTTCAAAACATATTCAAGCTCGATCCGACTCTGGATGGAAACAGGTCAGGTCGATGCTTCGGACAGCACT
TTCTTCGTGCGAACAAATCGTGAGAATGGGGATCTGCGGACTCTTTGGCATGACTGGTTTGTGCTTGATACGGGC
CACAGGCAGCAGAGGATCCCCCAGTTTCTCGAGGCCGGTGTGCAGAAAGTCTTCACTGCAGGAAAGAGCATGGTA
TTTCTCCGCCATCTAAATGCGCTACCAGACATTGAAGCCATGAAATTTGAGGACTTCTATTGCCAGGATTCTTCA
TTATTACTTCCTTTCCCCGCATTAGTAGAGTCTGCTTTTGAAAAACTCGTGGATGTGGACCATTCACTCAGTGCT
AGCTTATTACGAACTGAACTCGACCAACAATGCGGACTATGGACCTCCCTTGATGCTCTTCAACATGTCTACCTT
GCCAAAGACATGAGCGCCATCAGCATTGTTGACGCAAAAATCTTTGAGTTGATCGATCGGGGTCGTTCCTGGGAC
GACAGATTCCTGCTCACTGAGATATCAAGGACAGCTTTCAGTTCAATATCCGTCATTGACGTATCAAGACTCCTT
GTGCGGCCTGCTAGTACTTCATTGCGAGTTTCTCAAAATGATCATCGGACCGTGGGAATTCTAGAAGCAATCTCA
ATTGATTATGGCCTCCCGTGGCCTATTGCGAACATAATCACCGAGGACGCAATACAGGCATACCAACGAATCTCG
ACCTTCCTGATGCAGATCAGGCGCGCTAAATATGCCATTGTGAAACAGCGTATTCGCGACGCCCGTATCATCGCA
CCTGACGAAAAGGACACATTGGTACACGCTCTACATCATAACATGCTCTGGGTCCTCGATCTCATCTACGGCCAT
CTGACCTATCTCGTAATAACCACCACAACCCAATCTCTACACAAAGATCTATCTGGCGCACAAGATGTCGATGCC
ATGATAGCTGCCCACCAATCCTACATGTCCTCTTTGGAAGCCCAGTGTCTTCTTTCTGAAGATTTATCACATATC
CACGATGCAATCATCCATTTCTTAGATCTGTGTGTTCATTTCGCAGATCTACAAACCGCGCACTTGCTCGGCGAT
GAAGACCAATATCTGGAGAATCCGAAGGCGCTGCGCACAAAGAAAAAACCCGAAGAAGAATTCGAGTCTGATGAT
GATGAAGATGATGATGATAACGAGGCCTACGATCACGAACACACACTCACAGTCTCATTTCGTGACTCGACCTAT
AGCCAGCAGCTGAAAACGGTCAATTACCAGTTCAACCATCTAACGACCTTTGTCACGGATGGCTTGAAAAGTTTA
GTTCGTGCAGATGGGCTGCAAAGTTGGGATATTCTTGCCGACAGGCTCGAATGGCGGCGAAATTGGCGTAGGCTT
TGA
Gene >Pro_DTO377G3_2|g5468.t1
ATGGCTCTAGCGGCTGATCTGAGTACGCTTATCGACGCCTTAATCACTTCTGTCGCTAAGATATCACCAAACCAC
AAGGTAATATATTGAATTTCCATCAATCTCATATCGTCACACCCGGTGTACTCATATCTAAGTAGGGGTCTGCAC
GTGTCCAGAGTCTGAAGCGCCGTGTACAAGGAGCGCTCCGAACTGGTTCTCATACGCGCACCGACCAGTTTGCAG
TCGCCAAGCAACTCGAGGGACTACAGGAAAAGTTTCAAATCTTGAATAGAGATGAACTTGCTGAAGCTCTTCACG
CCCGCCTTGCGGAGCTGGAGAGCGACCGGATGCCCTGGCTTCCAGAGATTCTGAGTCTCTTATTGCAACTCTCAG
ATCGCCCCGCTCTTTTGTCAACGGTCAAACGTCCGAAGGAACGGGCCAAGGCACCAGAAGCAAAAGAGACTCTTT
CTTGGTCGGACCTTGATGCAGCTGGGACGGCATTCAGCGACGAAGAAATTTGGGAACAAGTAGACTTTGCTGGCG
ACTCATCAGATGACGACTTTTCATCCGTTGCCAGTGATGTATCTCTTCCCAAGGACAGACCTCAATCCGCCACAA
CAGTGGATGAAGGGTATATCATTCCAGATGACGTTTTTGTTTCGGAAGAGGATGGCGATCTTGTTGCCTCTATAG
AAAAGGCCCAATTTTGGAGAGCCGAGAATCACCATTCGTTGCCCCAAGCAGAAGCAACCACCTCGCGACTTATCA
CAGAATCCCAGCTTGCTAGGGAGACAATCTTCATGCTTCAGGGCCTTCCCACGTCTATTTACGTGCGCTTGGACG
ATGATTTTGGAGTGGATCGAAGATACACACTCGCACATTCATCCAACGAAGCCCTGGCATCGCTTTTGCAGTGTT
TCATTGAGATAGGCGCCAAGCTCAACGCTGTACGGTATTTCACCAAGCTTCCACAGACCATCCCATATATGCAAA
CGTTTTGCCGGAGCTTAGAAGAGCGTCTCCTTGAATTTGATAGAGTCTTATCTCAAGTTCAGTGCAAATACCTTT
CACCCGGTTCAACTGTCAGTCTCATCCAGCTTCTTGTTGATGTTCGTCAGCACTCTCATGAGCTAGCATTGCTCG
CAGACATGATCGCCAATTTAGAAAGAAACTCAAATGATCAACCAATGTGCTGCCTTGATTCCTTATACAACTTAG
TATGCATGCTGGAAGCCCTTGGCGACGAAAGTTCGTCTCAGCGCCTGGCGGAGCTATTTTTTATGTGTTTCAAAA
CATATTCAAGCTCGATCCGACTCTGGATGGAAACAGGTCAGGTCGATGCTTCGGACAGCACTTTCTTCGTGCGAA
CAAATCGTGAGAATGGGGATCTGCGGACTCTTTGGCATGACTGGTTTGTGCTTGATACGGGCCACAGGCAGCAGA
GGATCCCCCAGTTTCTCGAGGCCGGTGTGCAGAAAGTCTTCACTGCAGGAAAGAGCATGGTATTTCTCCGCCATC
TAAATGCGCTACCAGACATTGAAGCCATGAAATTTGAGGACTTCTATTGCCAGGATTCTTCATTATTACTTCCTT
TCCCCGCATTAGTAGAGTCTGCTTTTGAAAAACTCGTGGATGTGGACCATTCACTCAGTGCTAGCTTATTACGAA
CTGAACTCGACCAACAATGCGGACTATGGACCTCCCTTGATGCTCTTCAACATGTCTACCTTGCCAAAGACATGA
GCGCCATCAGCATTGTTGACGCAAAAATCTTTGAGTTGATCGATCGGGGTCGTTCCTGGGACGACAGATTCCTGC
TCACTGAGATATCAAGGACAGCTTTCAGTTCAATATCCGTCATTGACGTATCAAGACTCCTTGTGCGGCCTGCTA
GTACTTCATTGCGAGTTTCTCAAAATGATCATCGGACCGTGGGAATTCTAGAAGCAATCTCAATTGATTATGGCC
TCCCGTGGCCTATTGCGAACATAATCACCGAGGACGCAATACAGGCATACCAACGAATCTCGACCTTCCTGATGC
AGATCAGGCGCGCTAAATATGCCATTGTGAAACAGCGTATTCGCGACGCCCGTATCATCGCACCTGACGAAAAGG
ACACATTGGTACACGCTCTACATCATAACATGCTCTGGGTCCTCGATCTCATCTACGGCCATCTGACCTATCTCG
TAATAACCACCACAACCCAATCTCTACACAAAGATCTATCTGGCGCACAAGATGTCGATGCCATGATAGCTGCCC
ACCAATCCTACATGTCCTCTTTGGAAGCCCAGTGTCTTCTTTCTGAAGATTTATCACATATCCACGATGCAATCA
TCCATTTCTTAGATCTGTGTGTTCATTTCGCAGATCTACAAACCGCGCACTTGCTCGGCGATGAAGACCAATATC
TGGAGAATCCGAAGGCGCTGCGCACAAAGAAAAAACCCGAAGAAGAATTCGAGTCTGATGATGATGAAGATGATG
ATGATAACGAGGCCTACGATCACGAACACACACTCACAGTCTCATTTCGTGACTCGACCTATAGCCAGCAGCTGA
AAACGGTCAATTACCAGTTCAACCATCTAACGACCTTTGTCACGGATGGCTTGAAAAGTTTAGTTCGTGCAGATG
GGCTGCAAAGTTGGGATATTCTTGCCGACAGGCTCGAATGGCGGCGAAATTGGCGTAGGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail