Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5459.t1
Gene name
Locationscaffold_13:174450..175887
Strand+
Gene length (bp)1437
Transcript length (bp)1329
Coding sequence length (bp)1329
Protein length (aa) 443

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07571 TAF6_C TAF6 C-terminal HEAT repeat domain 3.3E-32 271 361
PF02969 TAF TATA box binding protein associated factor (TAF) 1.1E-23 1 66

GO

GO Term Description Terminal node
GO:0006352 DNA-templated transcription, initiation Yes
GO:0006367 transcription initiation from RNA polymerase II promoter Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5459.t1
MSVWNPDNIRDVAESVGILNLNNDVTENLARDVEYRVAQVLEEALKCMRHCKRTVLTTQDIALALRNLDVEPLYG
YDSTRPLKFGEASLGPGQPLFYVEDEEVDFEKLINAPLPKVPREVSFTAHWLAVEGVQPSIPQNPTAADSRNLEL
ISKGPNANSTLAAISGTGDVAVKPLVKHVLSRELQLYFEKVCSAFLNETSEDYRTSGYSSLREDPGLHQLVPYFV
QFIAEKVTHSLKNVFVLTQVMHMAEALVQNKSLYVDPYIASLVPSILTCLIGRQLGGPADLAESFALRDMAASLL
SLIAKKYSHSSHMLKPRLVRSCLKTFLDPSKPFGAHYGAVIGLQSVGGSEVIRVLVIPNLHEYTKLLGDGLDDAA
RRPAAERVLSALVAVLGSLRSSQPFLTNGHTVTDDLRSRLVDKVGDIIASRIVEAGEVQLAHIILES*
Coding >Pro_DTO377G3_2|g5459.t1
ATGTCTGTCTGGAACCCTGATAACATCCGCGATGTCGCCGAATCCGTCGGTATCCTCAACCTCAATAACGATGTG
ACCGAGAATCTCGCCCGGGACGTCGAATATCGAGTTGCGCAGGTCTTGGAGGAAGCACTGAAGTGTATGCGCCAC
TGTAAGCGAACGGTTCTTACCACTCAAGACATTGCGCTGGCATTGCGCAACCTGGACGTGGAGCCATTGTACGGC
TACGACTCCACCCGTCCGTTGAAGTTCGGCGAAGCCTCTCTAGGACCTGGCCAACCGCTGTTCTACGTTGAGGAT
GAGGAGGTTGACTTTGAGAAGTTGATCAATGCGCCCCTGCCAAAGGTTCCCCGCGAAGTCTCCTTCACTGCCCAC
TGGTTAGCTGTTGAAGGTGTGCAGCCGTCGATCCCCCAGAACCCGACCGCTGCCGATTCTCGTAACCTCGAATTG
ATCTCGAAGGGTCCGAACGCCAACTCCACACTGGCGGCAATCAGTGGCACAGGCGATGTGGCTGTCAAGCCACTG
GTCAAGCATGTGCTTTCAAGGGAACTCCAGCTCTACTTTGAAAAGGTCTGCAGTGCTTTCTTGAACGAAACAAGC
GAAGATTATCGCACCTCCGGGTATTCCAGCCTTCGCGAGGACCCAGGTCTGCACCAGCTGGTGCCATACTTTGTC
CAATTCATTGCCGAGAAGGTTACGCATAGTCTCAAGAATGTTTTCGTTCTCACTCAGGTGATGCACATGGCCGAG
GCGCTGGTTCAGAACAAGTCACTTTACGTAGACCCTTACATCGCATCCCTCGTACCATCCATTCTTACCTGCCTC
ATCGGTCGACAGCTCGGCGGACCTGCGGATCTCGCAGAGTCATTCGCTCTGCGCGATATGGCCGCCTCTCTCCTC
AGCCTAATCGCCAAAAAGTACTCCCACTCATCTCACATGCTCAAGCCTCGACTCGTGCGCTCCTGTCTCAAGACC
TTCCTCGACCCTTCAAAGCCATTCGGTGCTCACTATGGTGCTGTCATCGGACTGCAATCTGTCGGCGGCTCTGAA
GTAATCCGAGTGCTCGTCATTCCCAATTTGCACGAATATACTAAACTCCTCGGCGATGGATTGGACGATGCTGCT
CGTCGGCCAGCTGCCGAGCGAGTTCTGAGTGCACTTGTGGCTGTGTTGGGCTCGCTGCGTAGTAGTCAACCGTTT
TTGACCAATGGTCATACTGTCACAGACGACCTCCGCTCCAGACTAGTTGACAAAGTCGGTGATATCATTGCATCA
AGAATCGTGGAGGCTGGTGAGGTGCAGCTAGCACATATCATTTTGGAATCATGA
Transcript >Pro_DTO377G3_2|g5459.t1
ATGTCTGTCTGGAACCCTGATAACATCCGCGATGTCGCCGAATCCGTCGGTATCCTCAACCTCAATAACGATGTG
ACCGAGAATCTCGCCCGGGACGTCGAATATCGAGTTGCGCAGGTCTTGGAGGAAGCACTGAAGTGTATGCGCCAC
TGTAAGCGAACGGTTCTTACCACTCAAGACATTGCGCTGGCATTGCGCAACCTGGACGTGGAGCCATTGTACGGC
TACGACTCCACCCGTCCGTTGAAGTTCGGCGAAGCCTCTCTAGGACCTGGCCAACCGCTGTTCTACGTTGAGGAT
GAGGAGGTTGACTTTGAGAAGTTGATCAATGCGCCCCTGCCAAAGGTTCCCCGCGAAGTCTCCTTCACTGCCCAC
TGGTTAGCTGTTGAAGGTGTGCAGCCGTCGATCCCCCAGAACCCGACCGCTGCCGATTCTCGTAACCTCGAATTG
ATCTCGAAGGGTCCGAACGCCAACTCCACACTGGCGGCAATCAGTGGCACAGGCGATGTGGCTGTCAAGCCACTG
GTCAAGCATGTGCTTTCAAGGGAACTCCAGCTCTACTTTGAAAAGGTCTGCAGTGCTTTCTTGAACGAAACAAGC
GAAGATTATCGCACCTCCGGGTATTCCAGCCTTCGCGAGGACCCAGGTCTGCACCAGCTGGTGCCATACTTTGTC
CAATTCATTGCCGAGAAGGTTACGCATAGTCTCAAGAATGTTTTCGTTCTCACTCAGGTGATGCACATGGCCGAG
GCGCTGGTTCAGAACAAGTCACTTTACGTAGACCCTTACATCGCATCCCTCGTACCATCCATTCTTACCTGCCTC
ATCGGTCGACAGCTCGGCGGACCTGCGGATCTCGCAGAGTCATTCGCTCTGCGCGATATGGCCGCCTCTCTCCTC
AGCCTAATCGCCAAAAAGTACTCCCACTCATCTCACATGCTCAAGCCTCGACTCGTGCGCTCCTGTCTCAAGACC
TTCCTCGACCCTTCAAAGCCATTCGGTGCTCACTATGGTGCTGTCATCGGACTGCAATCTGTCGGCGGCTCTGAA
GTAATCCGAGTGCTCGTCATTCCCAATTTGCACGAATATACTAAACTCCTCGGCGATGGATTGGACGATGCTGCT
CGTCGGCCAGCTGCCGAGCGAGTTCTGAGTGCACTTGTGGCTGTGTTGGGCTCGCTGCGTAGTAGTCAACCGTTT
TTGACCAATGGTCATACTGTCACAGACGACCTCCGCTCCAGACTAGTTGACAAAGTCGGTGATATCATTGCATCA
AGAATCGTGGAGGCTGGTGAGGTGCAGCTAGCACATATCATTTTGGAATCATGA
Gene >Pro_DTO377G3_2|g5459.t1
ATGTCTGTCTGGAACCCTGATAACATCCGCGATGTCGCCGAATCCGTCGGTATCCTCAACCTCAATAACGATGTG
ACCGAGAATCTCGCCCGGGACGTCGAATATCGAGTTGCGCAGGTCTTGGAGGAAGCACTGAAGTGTATGCGCCAC
TGTAAGCGAACGGTTCTTACCACTCAAGACATTGCGCTGGCATTGCGCAACCTGGACGTGGAGCCATTGTACGGC
TACGACTCCACCCGTCCGTTGAAGTTCGGCGAAGCCTCTCTAGGACCTGGCCAACCGCTGTTCTACGTTGAGGAT
GAGGAGGTTGACTTTGAGAAGTTGATCAATGCGCCCCTGCCAAAGGTTCCCCGCGAAGTCTCCTTCACTGGTGAG
TGAATACTCTTCCCTACTTATGTGCTGTACAGCCTCTAACGTCTACTCTAGCCCACTGGTTAGCTGTTGAAGGTG
TGCAGCCGTCGATCCCCCAGAACCCGACCGCTGCCGATTCTCGTAACCTCGAATTGATCTCGAAGGGTCCGAACG
CCAACTCCACACTGGCGGCAATCAGTGGCACAGGCGATGTGGCTGTCAAGCCACTGGTCAAGCATGTGCTTTCAA
GGGAACTCCAGCTCTACTTTGAAAAGGTCTGCAGTGCTTTCTTGAACGAAACAAGCGAAGATTATCGCACCTCCG
GGTATTCCAGCCTTCGCGAGGACCCAGGTCTGCACCAGCTGGTGCCATACTTTGTCCAATTCATTGCCGAGAAGG
TTACGCATAGTCTCAAGAATGTTTTCGTTCTCACTCAGGTGATGCACATGGCCGAGGCGCTGGTTCAGAACAAGT
CACTTTACGTAGACCCTTACGTGAGCAAACCTACTATCAGAGAAGAACATGATCAGACGCTAACCGCATCAGATC
GCATCCCTCGTACCATCCATTCTTACCTGCCTCATCGGTCGACAGCTCGGCGGACCTGCGGATCTCGCAGAGTCA
TTCGCTCTGCGCGATATGGCCGCCTCTCTCCTCAGCCTAATCGCCAAAAAGTACTCCCACTCATCTCACATGCTC
AAGCCTCGACTCGTGCGCTCCTGTCTCAAGACCTTCCTCGACCCTTCAAAGCCATTCGGTGCTCACTATGGTGCT
GTCATCGGACTGCAATCTGTCGGCGGCTCTGAAGTAATCCGAGTGCTCGTCATTCCCAATTTGCACGAATATACT
AAACTCCTCGGCGATGGATTGGACGATGCTGCTCGTCGGCCAGCTGCCGAGCGAGTTCTGAGTGCACTTGTGGCT
GTGTTGGGCTCGCTGCGTAGTAGTCAACCGTTTTTGACCAATGGTCATACTGTCACAGACGACCTCCGCTCCAGA
CTAGTTGACAAAGTCGGTGATATCATTGCATCAAGAATCGTGGAGGCTGGTGAGGTGCAGCTAGCACATATCATT
TTGGAATCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail