Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5450.t1
Gene name
Locationscaffold_13:147835..148842
Strand+
Gene length (bp)1007
Transcript length (bp)516
Coding sequence length (bp)516
Protein length (aa) 172

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03134 TB2_DP1_HVA22 TB2/DP1, HVA22 family 2.0E-27 69 144

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 37 68 31
2 88 110 22
3 115 137 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1204.56 714.46 1694.65
5d_25C Five days - 25 degrees Celsius 1066.81 634.78 1498.84
7d_25C Seven days - 25 degrees Celsius 976.49 582.26 1370.73
10d_25C Ten days - 25 degrees Celsius 994.73 593.05 1396.42
7d_15C Seven days - 15 degrees Celsius 1389.72 814.83 1964.61
7d_30C Seven days - 30 degrees Celsius 971.25 579.11 1363.39

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.675291 no
3d_25C 7d_25C 0.412034 no
3d_25C 7d_15C 0.613077 no
3d_25C 7d_30C 0.399120 no
3d_25C 10d_25C 0.464367 no
5d_25C 7d_25C 0.772615 no
5d_25C 7d_15C 0.276299 no
5d_25C 7d_30C 0.755433 no
5d_25C 10d_25C 0.826723 no
7d_25C 7d_15C 0.123322 no
7d_25C 7d_30C 0.988193 no
7d_25C 10d_25C 0.957688 no
7d_15C 7d_30C 0.110690 no
7d_15C 10d_25C 0.140796 no
7d_30C 10d_25C 0.947757 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5450.t1
MASFQERAQHSIAQLDKELSKYPVLANLERQTNVPKVYVILGLIGIYFFLVFFNIAGEFLVNFAGFLIPGYYSLN
ALFTSSTQDDTQWLTYWVVFAFLTVIESAISAAYWFPFYYIFKFVLIMWMALPQTSGAQIVFNSFLQPVLGRFFS
SNGTSSNLRAQAEAASKPHST*
Coding >Pro_DTO377G3_2|g5450.t1
ATGGCCTCTTTCCAGGAACGTGCCCAGCACTCTATTGCTCAGCTCGACAAGGAGCTCTCCAAGTACCCTGTCCTT
GCCAACCTTGAGCGTCAGACCAATGTCCCCAAGGTCTATGTTATCCTTGGCCTTATCGGAATCTACTTCTTCCTT
GTCTTCTTTAACATTGCTGGCGAGTTCCTCGTCAACTTTGCCGGTTTCCTGATCCCCGGTTACTACTCCCTTAAC
GCACTTTTCACCTCAAGCACTCAGGATGACACCCAGTGGCTCACGTACTGGGTTGTGTTTGCTTTCCTGACTGTC
ATTGAGAGTGCCATCAGCGCTGCTTACTGGTTCCCCTTCTACTACATCTTCAAGTTCGTTCTGATCATGTGGATG
GCCCTTCCCCAGACCAGCGGTGCCCAAATTGTCTTCAACTCCTTCCTCCAGCCCGTGCTTGGCCGTTTCTTCAGC
TCCAACGGCACTTCCTCCAACCTGCGCGCTCAGGCCGAGGCTGCGAGCAAGCCCCACTCCACTTAA
Transcript >Pro_DTO377G3_2|g5450.t1
ATGGCCTCTTTCCAGGAACGTGCCCAGCACTCTATTGCTCAGCTCGACAAGGAGCTCTCCAAGTACCCTGTCCTT
GCCAACCTTGAGCGTCAGACCAATGTCCCCAAGGTCTATGTTATCCTTGGCCTTATCGGAATCTACTTCTTCCTT
GTCTTCTTTAACATTGCTGGCGAGTTCCTCGTCAACTTTGCCGGTTTCCTGATCCCCGGTTACTACTCCCTTAAC
GCACTTTTCACCTCAAGCACTCAGGATGACACCCAGTGGCTCACGTACTGGGTTGTGTTTGCTTTCCTGACTGTC
ATTGAGAGTGCCATCAGCGCTGCTTACTGGTTCCCCTTCTACTACATCTTCAAGTTCGTTCTGATCATGTGGATG
GCCCTTCCCCAGACCAGCGGTGCCCAAATTGTCTTCAACTCCTTCCTCCAGCCCGTGCTTGGCCGTTTCTTCAGC
TCCAACGGCACTTCCTCCAACCTGCGCGCTCAGGCCGAGGCTGCGAGCAAGCCCCACTCCACTTAA
Gene >Pro_DTO377G3_2|g5450.t1
ATGGCCTCTTTCCAGGAACGTGCCCAGCACTCTATTGCTCAGCTCGACAAGGAGGTACGTTTCCAGCCATTGTTG
TGTGTTTCGCTGTCCTCCTAGGTCAAACCCTCGCCTGGTGGCTGCAATGCCCCTAAGCGGTAGTGACCACAGCAG
GAGTATCTGCAATCACATCCTTTGATACATACTTCACTATAGTATCTATCGCTGTGGTTTTGAGCTAACATCTGC
TATTTCGTAGCTCTCCAAGTACCCTGTCCTTGCCAACCTTGAGCGTCAGACCAATGTCCCCAAGGTCTATGTTAT
CCTTGGCCTTATCGGAATCTACTTCTTCCTTGTCTTCTTTAACATTGCTGGCGAGTTCCTCGTCAACTTTGCCGG
TTTCCTGATCCCCGGTTACTACTCCCTTAACGCACTTTTCACCTCAAGCACTCAGGATGACACCCAGGTGAGTTT
TTTTTTTGTAAATTTCCCCCTTTACACACAAATTACTAACCTTGTCTTTTTTCGCTCCTCTAGTGGCTCACGGTA
TGTTCACATGATTTTATCACCTGGTTGTTACAATCGTGCGGAAGTAATCACCGCCGATTGTTATCATACACCACC
CACGTGACATATTTCCCGCTTGCACGCGATCAGTAATTCTAACATATGACTTGATAGTACTGGGTTGTGTTTGCT
TTCCTGACTGTCATTGAGAGTGCCATCAGCGCTGCTTACTGGTTCCGTACGTGCCCACAATATGCCGATTTTCTG
ACTATCTTGCTAACTGATCGCAGCCTTCTACTACATCTTCAAGTTCGTTCTGATCATGTGGATGGCCCTTCCCCA
GACCAGGTATGTTACTATTCCATGACCAAGTTAAGACCAGTAGCTGATCTCTTTTAAGCGGTGCCCAAATTGTCT
TCAACTCCTTCCTCCAGCCCGTGCTTGGCCGTTTCTTCAGCTCCAACGGCACTTCCTCCAACCTGCGCGCTCAGG
CCGAGGCTGCGAGCAAGCCCCACTCCACTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail