Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5444.t1
Gene name
Locationscaffold_13:129535..133090
Strand+
Gene length (bp)3555
Transcript length (bp)3507
Coding sequence length (bp)3507
Protein length (aa) 1169

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.6E-08 876 937
PF12796 Ank_2 Ankyrin repeats (3 copies) 8.2E-11 947 1034
PF12796 Ank_2 Ankyrin repeats (3 copies) 9.8E-15 1044 1136
PF13637 Ank_4 Ankyrin repeats (many copies) 4.9E-06 877 928
PF13637 Ank_4 Ankyrin repeats (many copies) 4.4E-06 1008 1059
PF13637 Ank_4 Ankyrin repeats (many copies) 6.2E-07 1041 1094
PF13637 Ank_4 Ankyrin repeats (many copies) 1.1E-06 1077 1127
PF13637 Ank_4 Ankyrin repeats (many copies) 1.1E-04 1109 1160
PF00023 Ank Ankyrin repeat 1.2E-03 877 904
PF00023 Ank Ankyrin repeat 1.4E-02 1077 1103
PF00023 Ank Ankyrin repeat 9.5E-03 1110 1136
PF17100 NACHT_N N-terminal domain of NWD NACHT-NTPase 6.7E-26 116 320

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1.74 0.55 2.93
5d_25C Five days - 25 degrees Celsius 1.85 0.59 3.10
7d_25C Seven days - 25 degrees Celsius 2.12 0.72 3.53
10d_25C Ten days - 25 degrees Celsius 2.29 0.80 3.78
7d_15C Seven days - 15 degrees Celsius 1.81 0.55 3.06
7d_30C Seven days - 30 degrees Celsius 3.95 1.65 6.25

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.921148 no
3d_25C 7d_25C 0.674702 no
3d_25C 7d_15C 0.945661 no
3d_25C 7d_30C 0.013513 yes
3d_25C 10d_25C 0.533069 no
5d_25C 7d_25C 0.780180 no
5d_25C 7d_15C 0.973462 no
5d_25C 7d_30C 0.028871 yes
5d_25C 10d_25C 0.644347 no
7d_25C 7d_15C 0.741075 no
7d_25C 7d_30C 0.060938 no
7d_25C 10d_25C 0.885476 no
7d_15C 7d_30C 0.019886 yes
7d_15C 10d_25C 0.599120 no
7d_30C 10d_25C 0.110419 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5444.t1
MEDPDRKMGKSTKMTNKLAAKLAKWRKKEKPDRTRGGALVVSPTAESNTSEPSMVNYVQPSDGLTGNPDKLSKPA
LVTSNTMPVSSLFEPLSLETTDVQPENFIPGPSSSPTTEDTWARAYKLLQAREPELVKDYQTHLSLAQPENSEHI
NLSNPHSVERVIKQLLEVRDQKQWRVSLVGKEVKIREQAEKLVKFLLWAEPAVKKAVSTQPYAALAWAGVSLLLP
LLTSSTTSNLAMLEGFDSIDHVQIYWDICEKTYLQSKDGEEYQALIQPLAKVYSFILEYQARAICHFSKAQVSRA
WENMTGESNWGKIRLTIEQLSDNCRSYVSPLKLGEVRRHRDRQLLEIKESRVILDGILDVLKADTSRNQKNYKDQ
NERGFLQALASDYEDGKNYNPLRIPGTCDWFLQGDVLRNWRDNDRSSLLWISAGPGCGKSVLSRALIDENRLSTN
ISTSTVCYFFFKDGDERRVSATDALCALLHQLFTHDSTGTLIQNAMPSHKNHGPNLVQNFSELWRLFIQCVSSPE
VGEIVCVLDALDECNDHSSRQLIRKLRELYSEPQVSSLTSKLKFLITGRPYDHLEASFQDFPDTTTCVRLDGDEK
TAEISNDIDLVIDARLQNLAQNLLESDRQMISDQLKSMENRTYLWLHLTFDIIEHSRSEYGRLSDMKELFSGLPS
KVSEAYEKILDRSGEKLQTENLLQIVLAASRPLSLDEANIALTMALRKGTFSSYDDLQKDSWPRDNFKGVVENLC
GLFINVYDSKLFFIHQTARDFLINPPRSGKWKGRLSMQHSHANMALLCLSFLSFLDGQSSVEQIEAKFPLARYSA
QHWMDHARPAETENEVQKSVMEFFLQENQAWGELFESIYYRRSYGRPHILATPLYYASSFGLQQTAQLLLAKGAD
VNAQIDNYGSALQAASDRGYIEIVELLLAHGAEINAQGGIYGNALEAASSGGHKEIMGLLLANGAGVNTQGSYGS
ALQAASVSGHTEIAELLLANGAETNTQGGFYGSVLQAASVNGHTEIAELLLANGADIRTQGGLYGGALQAASSNG
HKEMVELLLANGAEIDVNAQGGLDGNALQAASANGHKEIVELLLAHGAEINTQGGFYGSALQAASACGHKEVVEL
LLAKGAEINAQGGLYGSSFQAASACGHKEVVELLLAKGAEINA*
Coding >Pro_DTO377G3_2|g5444.t1
ATGGAAGACCCAGACCGGAAAATGGGTAAAAGTACAAAGATGACCAACAAACTGGCGGCGAAGCTAGCGAAATGG
AGAAAGAAGGAGAAACCCGATAGAACACGTGGAGGTGCCCTTGTCGTCTCTCCGACCGCAGAGTCAAACACGTCC
GAGCCTTCTATGGTAAACTATGTACAGCCTTCAGATGGCCTTACTGGAAATCCCGACAAGCTCTCCAAACCTGCT
TTGGTGACTTCCAATACCATGCCGGTCTCAAGTCTTTTCGAGCCCCTCTCGCTGGAAACGACCGACGTGCAGCCC
GAAAATTTCATACCCGGTCCATCATCTTCTCCTACGACCGAAGACACCTGGGCCCGGGCATATAAACTCTTGCAG
GCTCGAGAGCCCGAGTTGGTAAAAGATTATCAGACTCATTTGAGCCTAGCGCAACCCGAGAACTCAGAGCACATA
AATCTCTCAAATCCACACTCAGTTGAGCGGGTGATAAAGCAGCTGCTGGAAGTTCGGGACCAGAAGCAGTGGCGA
GTCTCACTAGTGGGAAAGGAGGTGAAGATACGAGAGCAAGCCGAAAAACTAGTTAAGTTTCTCCTCTGGGCCGAA
CCAGCCGTGAAGAAAGCCGTTAGCACCCAGCCATATGCAGCATTGGCGTGGGCTGGCGTTTCGCTGCTCTTACCT
CTTCTCACAAGCAGTACCACTAGCAATCTTGCGATGCTTGAAGGCTTCGATTCCATTGATCATGTTCAGATCTAC
TGGGATATCTGCGAGAAGACATACTTGCAGTCCAAGGATGGGGAAGAGTATCAAGCTCTCATCCAACCCCTTGCT
AAGGTCTACTCTTTTATACTCGAATACCAAGCACGTGCTATCTGTCATTTCTCAAAAGCTCAAGTCTCTCGCGCA
TGGGAGAACATGACGGGTGAAAGCAATTGGGGAAAAATAAGATTAACAATCGAACAATTGAGCGATAACTGTAGG
AGCTATGTCTCCCCCCTCAAACTTGGGGAGGTTCGCCGTCATCGAGATCGTCAATTACTGGAGATTAAAGAGTCT
CGGGTTATTCTTGATGGCATTTTGGATGTCCTAAAAGCGGACACGAGTCGGAACCAGAAGAATTATAAAGACCAG
AACGAGCGAGGGTTTCTTCAAGCACTTGCGTCCGACTACGAGGATGGCAAGAATTATAACCCACTGAGAATCCCA
GGGACATGCGATTGGTTCTTACAGGGTGACGTACTTCGAAACTGGCGGGATAACGACCGCTCCAGTCTTCTGTGG
ATTTCCGCTGGGCCTGGCTGTGGAAAGTCGGTGTTGTCACGGGCTCTCATTGACGAGAATCGGCTTTCTACGAAT
ATTTCGACATCTACTGTCTGCTATTTCTTTTTCAAAGATGGGGATGAGCGCCGCGTGTCAGCCACTGATGCTTTG
TGCGCATTGCTTCACCAACTTTTCACCCACGATTCGACGGGCACACTGATCCAAAATGCAATGCCCAGCCACAAA
AATCACGGCCCAAATCTAGTACAGAACTTCTCTGAGCTGTGGCGTCTGTTCATCCAATGCGTCAGCTCGCCAGAG
GTTGGAGAGATAGTTTGTGTCCTTGATGCCCTGGATGAATGCAATGATCATAGCAGTCGGCAATTGATCCGCAAA
CTAAGGGAGCTTTACTCCGAGCCCCAAGTTTCATCTTTAACCTCGAAACTGAAGTTTCTGATCACTGGTCGCCCT
TATGATCACCTGGAGGCATCGTTCCAAGATTTCCCTGATACAACAACTTGTGTGCGCTTGGACGGAGATGAAAAG
ACCGCCGAAATCAGCAACGATATAGATCTGGTCATCGATGCTAGACTACAAAACCTCGCCCAAAACCTCCTAGAG
AGCGACCGTCAAATGATTTCAGATCAACTCAAGAGCATGGAGAATCGTACTTACCTCTGGCTACATCTCACTTTC
GATATTATTGAGCATAGCCGGAGTGAGTATGGTCGACTGTCCGATATGAAAGAACTATTCTCTGGGCTGCCTTCT
AAGGTCTCAGAAGCGTATGAGAAGATTCTGGATCGGAGCGGGGAAAAGCTCCAGACAGAAAATCTCCTTCAAATT
GTCTTAGCTGCATCACGACCTCTATCACTTGACGAAGCCAACATAGCCTTAACGATGGCTTTGAGAAAGGGCACT
TTTAGTTCTTACGACGATCTCCAGAAAGATTCTTGGCCGAGAGATAACTTCAAAGGCGTTGTGGAAAATCTTTGC
GGTCTCTTCATCAATGTGTACGATTCTAAGTTGTTTTTTATCCATCAGACAGCCAGAGATTTTCTCATCAACCCT
CCTCGGAGTGGAAAGTGGAAGGGGCGGCTGAGTATGCAACATTCACACGCGAACATGGCGCTGTTGTGTCTATCA
TTCTTGTCGTTTCTAGATGGGCAATCATCAGTGGAGCAAATCGAGGCAAAGTTTCCGTTGGCGCGGTACTCGGCC
CAGCATTGGATGGATCATGCACGGCCTGCGGAGACAGAGAACGAAGTCCAGAAAAGCGTCATGGAGTTTTTCCTT
CAAGAAAATCAAGCTTGGGGTGAGCTCTTTGAGTCGATTTATTACCGGCGGTCATATGGACGACCCCACATCCTG
GCAACTCCACTATACTACGCATCGTCCTTCGGTCTCCAACAAACAGCACAACTCCTATTGGCTAAAGGCGCGGAT
GTCAACGCGCAGATTGACAATTATGGAAGTGCACTCCAGGCGGCTTCTGATAGAGGTTACATAGAGATTGTGGAG
CTACTGTTAGCCCATGGCGCGGAAATCAACGCACAGGGTGGCATTTACGGAAATGCACTCGAGGCGGCTTCCTCT
GGCGGCCATAAAGAGATCATGGGGCTACTATTAGCCAATGGCGCGGGGGTCAATACGCAGGGCTCTTATGGAAGC
GCACTCCAGGCGGCTTCCGTTAGTGGTCATACAGAGATTGCGGAGCTGCTATTAGCCAATGGTGCGGAGACCAAT
ACGCAGGGCGGCTTTTATGGGAGCGTACTCCAGGCGGCTTCCGTTAATGGTCATACAGAGATTGCGGAGCTGCTA
TTAGCCAATGGTGCGGATATCAGGACGCAGGGTGGCTTATATGGAGGTGCACTCCAGGCGGCTTCCTCTAATGGT
CATAAAGAGATGGTCGAGCTGCTATTAGCCAATGGCGCGGAGATCGATGTCAACGCTCAGGGCGGCTTAGATGGA
AATGCACTCCAGGCGGCCTCCGCTAATGGTCATAAAGAGATTGTGGAGCTGCTATTAGCTCATGGCGCAGAGATT
AATACACAGGGTGGCTTTTATGGAAGTGCACTCCAGGCGGCTTCTGCTTGCGGTCACAAAGAGGTCGTGGAGCTT
CTATTAGCTAAGGGCGCGGAGATCAACGCGCAGGGAGGCTTATATGGAAGTTCATTCCAGGCGGCTTCCGCTTGC
GGTCACAAAGAGGTTGTGGAGCTACTATTAGCCAAGGGCGCGGAGATCAACGCGTAG
Transcript >Pro_DTO377G3_2|g5444.t1
ATGGAAGACCCAGACCGGAAAATGGGTAAAAGTACAAAGATGACCAACAAACTGGCGGCGAAGCTAGCGAAATGG
AGAAAGAAGGAGAAACCCGATAGAACACGTGGAGGTGCCCTTGTCGTCTCTCCGACCGCAGAGTCAAACACGTCC
GAGCCTTCTATGGTAAACTATGTACAGCCTTCAGATGGCCTTACTGGAAATCCCGACAAGCTCTCCAAACCTGCT
TTGGTGACTTCCAATACCATGCCGGTCTCAAGTCTTTTCGAGCCCCTCTCGCTGGAAACGACCGACGTGCAGCCC
GAAAATTTCATACCCGGTCCATCATCTTCTCCTACGACCGAAGACACCTGGGCCCGGGCATATAAACTCTTGCAG
GCTCGAGAGCCCGAGTTGGTAAAAGATTATCAGACTCATTTGAGCCTAGCGCAACCCGAGAACTCAGAGCACATA
AATCTCTCAAATCCACACTCAGTTGAGCGGGTGATAAAGCAGCTGCTGGAAGTTCGGGACCAGAAGCAGTGGCGA
GTCTCACTAGTGGGAAAGGAGGTGAAGATACGAGAGCAAGCCGAAAAACTAGTTAAGTTTCTCCTCTGGGCCGAA
CCAGCCGTGAAGAAAGCCGTTAGCACCCAGCCATATGCAGCATTGGCGTGGGCTGGCGTTTCGCTGCTCTTACCT
CTTCTCACAAGCAGTACCACTAGCAATCTTGCGATGCTTGAAGGCTTCGATTCCATTGATCATGTTCAGATCTAC
TGGGATATCTGCGAGAAGACATACTTGCAGTCCAAGGATGGGGAAGAGTATCAAGCTCTCATCCAACCCCTTGCT
AAGGTCTACTCTTTTATACTCGAATACCAAGCACGTGCTATCTGTCATTTCTCAAAAGCTCAAGTCTCTCGCGCA
TGGGAGAACATGACGGGTGAAAGCAATTGGGGAAAAATAAGATTAACAATCGAACAATTGAGCGATAACTGTAGG
AGCTATGTCTCCCCCCTCAAACTTGGGGAGGTTCGCCGTCATCGAGATCGTCAATTACTGGAGATTAAAGAGTCT
CGGGTTATTCTTGATGGCATTTTGGATGTCCTAAAAGCGGACACGAGTCGGAACCAGAAGAATTATAAAGACCAG
AACGAGCGAGGGTTTCTTCAAGCACTTGCGTCCGACTACGAGGATGGCAAGAATTATAACCCACTGAGAATCCCA
GGGACATGCGATTGGTTCTTACAGGGTGACGTACTTCGAAACTGGCGGGATAACGACCGCTCCAGTCTTCTGTGG
ATTTCCGCTGGGCCTGGCTGTGGAAAGTCGGTGTTGTCACGGGCTCTCATTGACGAGAATCGGCTTTCTACGAAT
ATTTCGACATCTACTGTCTGCTATTTCTTTTTCAAAGATGGGGATGAGCGCCGCGTGTCAGCCACTGATGCTTTG
TGCGCATTGCTTCACCAACTTTTCACCCACGATTCGACGGGCACACTGATCCAAAATGCAATGCCCAGCCACAAA
AATCACGGCCCAAATCTAGTACAGAACTTCTCTGAGCTGTGGCGTCTGTTCATCCAATGCGTCAGCTCGCCAGAG
GTTGGAGAGATAGTTTGTGTCCTTGATGCCCTGGATGAATGCAATGATCATAGCAGTCGGCAATTGATCCGCAAA
CTAAGGGAGCTTTACTCCGAGCCCCAAGTTTCATCTTTAACCTCGAAACTGAAGTTTCTGATCACTGGTCGCCCT
TATGATCACCTGGAGGCATCGTTCCAAGATTTCCCTGATACAACAACTTGTGTGCGCTTGGACGGAGATGAAAAG
ACCGCCGAAATCAGCAACGATATAGATCTGGTCATCGATGCTAGACTACAAAACCTCGCCCAAAACCTCCTAGAG
AGCGACCGTCAAATGATTTCAGATCAACTCAAGAGCATGGAGAATCGTACTTACCTCTGGCTACATCTCACTTTC
GATATTATTGAGCATAGCCGGAGTGAGTATGGTCGACTGTCCGATATGAAAGAACTATTCTCTGGGCTGCCTTCT
AAGGTCTCAGAAGCGTATGAGAAGATTCTGGATCGGAGCGGGGAAAAGCTCCAGACAGAAAATCTCCTTCAAATT
GTCTTAGCTGCATCACGACCTCTATCACTTGACGAAGCCAACATAGCCTTAACGATGGCTTTGAGAAAGGGCACT
TTTAGTTCTTACGACGATCTCCAGAAAGATTCTTGGCCGAGAGATAACTTCAAAGGCGTTGTGGAAAATCTTTGC
GGTCTCTTCATCAATGTGTACGATTCTAAGTTGTTTTTTATCCATCAGACAGCCAGAGATTTTCTCATCAACCCT
CCTCGGAGTGGAAAGTGGAAGGGGCGGCTGAGTATGCAACATTCACACGCGAACATGGCGCTGTTGTGTCTATCA
TTCTTGTCGTTTCTAGATGGGCAATCATCAGTGGAGCAAATCGAGGCAAAGTTTCCGTTGGCGCGGTACTCGGCC
CAGCATTGGATGGATCATGCACGGCCTGCGGAGACAGAGAACGAAGTCCAGAAAAGCGTCATGGAGTTTTTCCTT
CAAGAAAATCAAGCTTGGGGTGAGCTCTTTGAGTCGATTTATTACCGGCGGTCATATGGACGACCCCACATCCTG
GCAACTCCACTATACTACGCATCGTCCTTCGGTCTCCAACAAACAGCACAACTCCTATTGGCTAAAGGCGCGGAT
GTCAACGCGCAGATTGACAATTATGGAAGTGCACTCCAGGCGGCTTCTGATAGAGGTTACATAGAGATTGTGGAG
CTACTGTTAGCCCATGGCGCGGAAATCAACGCACAGGGTGGCATTTACGGAAATGCACTCGAGGCGGCTTCCTCT
GGCGGCCATAAAGAGATCATGGGGCTACTATTAGCCAATGGCGCGGGGGTCAATACGCAGGGCTCTTATGGAAGC
GCACTCCAGGCGGCTTCCGTTAGTGGTCATACAGAGATTGCGGAGCTGCTATTAGCCAATGGTGCGGAGACCAAT
ACGCAGGGCGGCTTTTATGGGAGCGTACTCCAGGCGGCTTCCGTTAATGGTCATACAGAGATTGCGGAGCTGCTA
TTAGCCAATGGTGCGGATATCAGGACGCAGGGTGGCTTATATGGAGGTGCACTCCAGGCGGCTTCCTCTAATGGT
CATAAAGAGATGGTCGAGCTGCTATTAGCCAATGGCGCGGAGATCGATGTCAACGCTCAGGGCGGCTTAGATGGA
AATGCACTCCAGGCGGCCTCCGCTAATGGTCATAAAGAGATTGTGGAGCTGCTATTAGCTCATGGCGCAGAGATT
AATACACAGGGTGGCTTTTATGGAAGTGCACTCCAGGCGGCTTCTGCTTGCGGTCACAAAGAGGTCGTGGAGCTT
CTATTAGCTAAGGGCGCGGAGATCAACGCGCAGGGAGGCTTATATGGAAGTTCATTCCAGGCGGCTTCCGCTTGC
GGTCACAAAGAGGTTGTGGAGCTACTATTAGCCAAGGGCGCGGAGATCAACGCGTAG
Gene >Pro_DTO377G3_2|g5444.t1
ATGGAAGACCCAGACCGGAAAATGGGTAAAAGTACAAAGATGACCAACAAACTGGCGGCGAAGCTAGCGAAATGG
AGAAAGAAGGAGAAACCCGATAGAACACGTGGAGGTGCCCTTGTCGTCTCTCCGACCGCAGAGTCAAACACGTCC
GAGCCTTCTATGGTAAACTATGTACAGCCTTCAGATGGCCTTACTGGAAATCCCGACAAGCTCTCCAAACCTGCT
TTGGTGACTTCCAATACCATGCCGGTCTCAAGTCTTTTCGAGCCCCTCTCGCTGGAAACGACCGACGTGCAGCCC
GAAAATTTCATACCCGGTCCATCATCTTCTCCTACGACCGAAGACACCTGGGCCCGGGCATATAAACTCTTGCAG
GCTCGAGAGCCCGAGTTGGTAAAAGATTATCAGACTCATTTGAGCCTAGCGCAACCCGAGAACTCAGAGCACATA
AATCTCTCAAATCCACACTCAGTTGAGCGGGTGATAAAGCAGCTGCTGGAAGTTCGGGACCAGAAGCAGTGGCGA
GTCTCACTAGTGGGAAAGGAGGTGAAGATACGAGAGCAAGCCGAAAAACTAGTTAAGTTTCTCCTCTGGGCCGAA
CCAGCCGTGAAGAAAGCCGTTAGCACCCAGCCATATGCAGCATTGGCGTGGGCTGGCGTTTCGCTGCTCTTACCT
GTAAGCCAAGCAATCCTCCTATTATCTAGCCAAGGCTGACCCAGACAGCTTCTCACAAGCAGTACCACTAGCAAT
CTTGCGATGCTTGAAGGCTTCGATTCCATTGATCATGTTCAGATCTACTGGGATATCTGCGAGAAGACATACTTG
CAGTCCAAGGATGGGGAAGAGTATCAAGCTCTCATCCAACCCCTTGCTAAGGTCTACTCTTTTATACTCGAATAC
CAAGCACGTGCTATCTGTCATTTCTCAAAAGCTCAAGTCTCTCGCGCATGGGAGAACATGACGGGTGAAAGCAAT
TGGGGAAAAATAAGATTAACAATCGAACAATTGAGCGATAACTGTAGGAGCTATGTCTCCCCCCTCAAACTTGGG
GAGGTTCGCCGTCATCGAGATCGTCAATTACTGGAGATTAAAGAGTCTCGGGTTATTCTTGATGGCATTTTGGAT
GTCCTAAAAGCGGACACGAGTCGGAACCAGAAGAATTATAAAGACCAGAACGAGCGAGGGTTTCTTCAAGCACTT
GCGTCCGACTACGAGGATGGCAAGAATTATAACCCACTGAGAATCCCAGGGACATGCGATTGGTTCTTACAGGGT
GACGTACTTCGAAACTGGCGGGATAACGACCGCTCCAGTCTTCTGTGGATTTCCGCTGGGCCTGGCTGTGGAAAG
TCGGTGTTGTCACGGGCTCTCATTGACGAGAATCGGCTTTCTACGAATATTTCGACATCTACTGTCTGCTATTTC
TTTTTCAAAGATGGGGATGAGCGCCGCGTGTCAGCCACTGATGCTTTGTGCGCATTGCTTCACCAACTTTTCACC
CACGATTCGACGGGCACACTGATCCAAAATGCAATGCCCAGCCACAAAAATCACGGCCCAAATCTAGTACAGAAC
TTCTCTGAGCTGTGGCGTCTGTTCATCCAATGCGTCAGCTCGCCAGAGGTTGGAGAGATAGTTTGTGTCCTTGAT
GCCCTGGATGAATGCAATGATCATAGCAGTCGGCAATTGATCCGCAAACTAAGGGAGCTTTACTCCGAGCCCCAA
GTTTCATCTTTAACCTCGAAACTGAAGTTTCTGATCACTGGTCGCCCTTATGATCACCTGGAGGCATCGTTCCAA
GATTTCCCTGATACAACAACTTGTGTGCGCTTGGACGGAGATGAAAAGACCGCCGAAATCAGCAACGATATAGAT
CTGGTCATCGATGCTAGACTACAAAACCTCGCCCAAAACCTCCTAGAGAGCGACCGTCAAATGATTTCAGATCAA
CTCAAGAGCATGGAGAATCGTACTTACCTCTGGCTACATCTCACTTTCGATATTATTGAGCATAGCCGGAGTGAG
TATGGTCGACTGTCCGATATGAAAGAACTATTCTCTGGGCTGCCTTCTAAGGTCTCAGAAGCGTATGAGAAGATT
CTGGATCGGAGCGGGGAAAAGCTCCAGACAGAAAATCTCCTTCAAATTGTCTTAGCTGCATCACGACCTCTATCA
CTTGACGAAGCCAACATAGCCTTAACGATGGCTTTGAGAAAGGGCACTTTTAGTTCTTACGACGATCTCCAGAAA
GATTCTTGGCCGAGAGATAACTTCAAAGGCGTTGTGGAAAATCTTTGCGGTCTCTTCATCAATGTGTACGATTCT
AAGTTGTTTTTTATCCATCAGACAGCCAGAGATTTTCTCATCAACCCTCCTCGGAGTGGAAAGTGGAAGGGGCGG
CTGAGTATGCAACATTCACACGCGAACATGGCGCTGTTGTGTCTATCATTCTTGTCGTTTCTAGATGGGCAATCA
TCAGTGGAGCAAATCGAGGCAAAGTTTCCGTTGGCGCGGTACTCGGCCCAGCATTGGATGGATCATGCACGGCCT
GCGGAGACAGAGAACGAAGTCCAGAAAAGCGTCATGGAGTTTTTCCTTCAAGAAAATCAAGCTTGGGGTGAGCTC
TTTGAGTCGATTTATTACCGGCGGTCATATGGACGACCCCACATCCTGGCAACTCCACTATACTACGCATCGTCC
TTCGGTCTCCAACAAACAGCACAACTCCTATTGGCTAAAGGCGCGGATGTCAACGCGCAGATTGACAATTATGGA
AGTGCACTCCAGGCGGCTTCTGATAGAGGTTACATAGAGATTGTGGAGCTACTGTTAGCCCATGGCGCGGAAATC
AACGCACAGGGTGGCATTTACGGAAATGCACTCGAGGCGGCTTCCTCTGGCGGCCATAAAGAGATCATGGGGCTA
CTATTAGCCAATGGCGCGGGGGTCAATACGCAGGGCTCTTATGGAAGCGCACTCCAGGCGGCTTCCGTTAGTGGT
CATACAGAGATTGCGGAGCTGCTATTAGCCAATGGTGCGGAGACCAATACGCAGGGCGGCTTTTATGGGAGCGTA
CTCCAGGCGGCTTCCGTTAATGGTCATACAGAGATTGCGGAGCTGCTATTAGCCAATGGTGCGGATATCAGGACG
CAGGGTGGCTTATATGGAGGTGCACTCCAGGCGGCTTCCTCTAATGGTCATAAAGAGATGGTCGAGCTGCTATTA
GCCAATGGCGCGGAGATCGATGTCAACGCTCAGGGCGGCTTAGATGGAAATGCACTCCAGGCGGCCTCCGCTAAT
GGTCATAAAGAGATTGTGGAGCTGCTATTAGCTCATGGCGCAGAGATTAATACACAGGGTGGCTTTTATGGAAGT
GCACTCCAGGCGGCTTCTGCTTGCGGTCACAAAGAGGTCGTGGAGCTTCTATTAGCTAAGGGCGCGGAGATCAAC
GCGCAGGGAGGCTTATATGGAAGTTCATTCCAGGCGGCTTCCGCTTGCGGTCACAAAGAGGTTGTGGAGCTACTA
TTAGCCAAGGGCGCGGAGATCAACGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail