Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5441.t1
Gene name
Locationscaffold_13:119762..120722
Strand-
Gene length (bp)960
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 8.12 2.59 13.65
5d_25C Five days - 25 degrees Celsius 2.87 0.35 5.39
7d_25C Seven days - 25 degrees Celsius 4.28 0.69 7.86
10d_25C Ten days - 25 degrees Celsius 0.86 0.00 1.97
7d_15C Seven days - 15 degrees Celsius 4.46 0.97 7.94
7d_30C Seven days - 30 degrees Celsius 3.35 0.60 6.10

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.021163 yes
3d_25C 7d_25C 0.146409 no
3d_25C 7d_15C 0.151518 no
3d_25C 7d_30C 0.026584 yes
3d_25C 10d_25C 0.003625 yes
5d_25C 7d_25C 0.484930 no
5d_25C 7d_15C 0.403387 no
5d_25C 7d_30C 0.812838 no
5d_25C 10d_25C 0.073778 no
7d_25C 7d_15C 0.953318 no
7d_25C 7d_30C 0.672504 no
7d_25C 10d_25C 0.022940 yes
7d_15C 7d_30C 0.592579 no
7d_15C 10d_25C 0.018295 yes
7d_30C 10d_25C 0.046552 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5441.t1
MRFNPTLSLAMVASATAAQLTTQLFNFTSSINIENSQLRPNGHLLLTTFYEAHLYTINPLARNPQAELVAALPGA
TALTGIAAVGHDKYAVVGGVRGSYHYDNETIYTVDFSKNATNPTIQTVAHIPDADMLNGMASMPSQPHILLIADA
RLGSIFRVDITTGVSKVVLKNDALAAPANSSMPIGINGLQVVGGNVYFTNSALNIFARVAVSEDGGTFGRIQVIA
QLVREAGDTDSDWDDFAIDASGNAYVAQPSNAIAKITPDGTQSVVAGGGDSLAFIGPTSVQIVPGGKLAYVTTRG
GDQGGVSYGGQVVALRLRE*
Coding >Pro_DTO377G3_2|g5441.t1
ATGCGTTTCAATCCTACATTGAGCCTGGCCATGGTGGCCAGCGCCACAGCCGCCCAATTGACAACCCAACTATTC
AACTTCACCAGCTCAATCAACATCGAAAACAGCCAGCTCCGGCCCAACGGCCATCTCCTCCTCACAACATTCTAC
GAAGCCCATCTCTACACAATCAACCCGCTCGCCCGCAATCCCCAAGCCGAGCTAGTCGCCGCGCTCCCCGGCGCC
ACAGCTCTAACCGGCATTGCAGCCGTCGGCCACGACAAGTATGCCGTCGTAGGCGGAGTCCGGGGCTCATACCAC
TACGACAACGAAACCATCTACACTGTCGACTTTAGCAAGAATGCCACAAACCCCACCATCCAGACCGTCGCGCAC
ATCCCGGACGCCGATATGCTAAACGGCATGGCCTCAATGCCGTCGCAGCCGCATATTCTCCTGATCGCGGACGCG
CGGTTGGGATCCATATTCCGCGTCGACATCACTACCGGTGTCTCGAAGGTTGTGTTGAAGAACGACGCCCTGGCC
GCGCCTGCGAACTCGTCCATGCCCATCGGCATCAATGGTCTGCAGGTTGTCGGAGGTAATGTGTACTTCACCAAT
AGTGCGCTTAATATATTCGCCCGGGTGGCTGTCAGCGAAGACGGGGGGACTTTCGGTCGTATTCAGGTCATTGCG
CAGTTGGTGCGCGAGGCCGGCGATACGGATTCGGATTGGGATGATTTTGCGATTGATGCTAGTGGTAATGCTTAT
GTGGCGCAGCCGTCTAATGCCATTGCTAAGATCACGCCGGATGGAACGCAGAGTGTCGTTGCTGGTGGGGGTGAT
AGCTTGGCTTTTATTGGCCCTACTTCTGTGCAGATCGTGCCGGGTGGGAAATTGGCTTATGTTACTACTCGTGGA
GGTGACCAGGGGGGTGTCTCTTATGGTGGGCAGGTTGTTGCGCTTCGGCTTCGCGAGTAG
Transcript >Pro_DTO377G3_2|g5441.t1
ATGCGTTTCAATCCTACATTGAGCCTGGCCATGGTGGCCAGCGCCACAGCCGCCCAATTGACAACCCAACTATTC
AACTTCACCAGCTCAATCAACATCGAAAACAGCCAGCTCCGGCCCAACGGCCATCTCCTCCTCACAACATTCTAC
GAAGCCCATCTCTACACAATCAACCCGCTCGCCCGCAATCCCCAAGCCGAGCTAGTCGCCGCGCTCCCCGGCGCC
ACAGCTCTAACCGGCATTGCAGCCGTCGGCCACGACAAGTATGCCGTCGTAGGCGGAGTCCGGGGCTCATACCAC
TACGACAACGAAACCATCTACACTGTCGACTTTAGCAAGAATGCCACAAACCCCACCATCCAGACCGTCGCGCAC
ATCCCGGACGCCGATATGCTAAACGGCATGGCCTCAATGCCGTCGCAGCCGCATATTCTCCTGATCGCGGACGCG
CGGTTGGGATCCATATTCCGCGTCGACATCACTACCGGTGTCTCGAAGGTTGTGTTGAAGAACGACGCCCTGGCC
GCGCCTGCGAACTCGTCCATGCCCATCGGCATCAATGGTCTGCAGGTTGTCGGAGGTAATGTGTACTTCACCAAT
AGTGCGCTTAATATATTCGCCCGGGTGGCTGTCAGCGAAGACGGGGGGACTTTCGGTCGTATTCAGGTCATTGCG
CAGTTGGTGCGCGAGGCCGGCGATACGGATTCGGATTGGGATGATTTTGCGATTGATGCTAGTGGTAATGCTTAT
GTGGCGCAGCCGTCTAATGCCATTGCTAAGATCACGCCGGATGGAACGCAGAGTGTCGTTGCTGGTGGGGGTGAT
AGCTTGGCTTTTATTGGCCCTACTTCTGTGCAGATCGTGCCGGGTGGGAAATTGGCTTATGTTACTACTCGTGGA
GGTGACCAGGGGGGTGTCTCTTATGGTGGGCAGGTTGTTGCGCTTCGGCTTCGCGAGTAG
Gene >Pro_DTO377G3_2|g5441.t1
ATGCGTTTCAATCCTACATTGAGCCTGGCCATGGTGGCCAGCGCCACAGCCGCCCAATTGACAACCCAACTATTC
AACTTCACCAGCTCAATCAACATCGAAAACAGCCAGCTCCGGCCCAACGGCCATCTCCTCCTCACAACATTCTAC
GAAGCCCATCTCTACACAATCAACCCGCTCGCCCGCAATCCCCAAGCCGAGCTAGTCGCCGCGCTCCCCGGCGCC
ACAGCTCTAACCGGCATTGCAGCCGTCGGCCACGACAAGTATGCCGTCGTAGGCGGAGTCCGGGGCTCATACCAC
TACGACAACGAAACCATCTACACTGTCGACTTTAGCAAGAATGCCACAAACCCCACCATCCAGACCGTCGCGCAC
ATCCCGGACGCCGATATGCTAAACGGCATGGCCTCAATGCCGTCGCAGCCGCATATTCTCCTGATCGCGGACGCG
CGGTTGGGATCCATATTCCGCGTCGACATCACTACCGGTGTCTCGAAGGTTGTGTTGAAGAACGACGCCCTGGCC
GCGCCTGCGAACTCGTCCATGCCCATCGGCATCAATGGTCTGCAGGTTGTCGGAGGTAATGTGTACTTCACCAAT
AGTGCGCTTAATATATTCGCCCGGGTGGCTGTCAGCGAAGACGGGGGGACTTTCGGTCGTATTCAGGTCATTGCG
CAGTTGGTGCGCGAGGCCGGCGATACGGATTCGGATTGGGATGATTTTGCGATTGATGCTAGTGGTAATGCTTAT
GTGGCGCAGCCGTCTAATGCCATTGCTAAGATCACGCCGGATGGAACGCAGAGTGTCGTTGCTGGTGGGGGTGAT
AGCTTGGCTTTTATTGGCCCTACTTCTGTGCAGATCGTGCCGGGTGGGAAATTGGCTTATGTTACTACTCGTGGA
GGTGACCAGGGGGGTGTCTCTTATGGTGGGCAGGTTGTTGCGCTTCGGCTTCGCGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail