Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5435.t1
Gene name
Locationscaffold_13:99734..101253
Strand-
Gene length (bp)1519
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04389 Peptidase_M28 Peptidase family M28 5.1E-40 229 433
PF02225 PA PA domain 1.2E-13 118 201

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 12.07 5.31 18.83
5d_25C Five days - 25 degrees Celsius 10.19 4.23 16.14
7d_25C Seven days - 25 degrees Celsius 9.50 3.79 15.22
10d_25C Ten days - 25 degrees Celsius 6.34 2.26 10.43
7d_15C Seven days - 15 degrees Celsius 8.03 2.45 13.61
7d_30C Seven days - 30 degrees Celsius 24.69 12.82 36.55

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.671988 no
3d_25C 7d_25C 0.534342 no
3d_25C 7d_15C 0.284231 no
3d_25C 7d_30C 0.010411 yes
3d_25C 10d_25C 0.046552 yes
5d_25C 7d_25C 0.888602 no
5d_25C 7d_15C 0.591349 no
5d_25C 7d_30C 0.001804 yes
5d_25C 10d_25C 0.169507 no
7d_25C 7d_15C 0.731463 no
7d_25C 7d_30C 0.001804 yes
7d_25C 10d_25C 0.268009 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.608056 no
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5435.t1
MKWLFLITLSVGLAEAGRRKPLVSPNDFPSTIRLKDLLKGTQQLEDFAYAYPERNRVFGSAAHNDTVDFIYRELK
KTGYYNVWKQPQVHTWTTANTSLTLEGESIKASAMTYSPSVEVTAELAVVSNLGCSASDYPSDVAGAIALVQRGE
CTFAEKSLLAAAANAAAVIVYNNVAGSLSGTLGGVSSDYSAIAGVSDVDGKVLLSAAEKGAVTVSLLLDSRVENR
TTFNVIAETKGGDHNNVVSLGGHTDSVDAGPGINDDGSGIISNLVVAKALTRFSVKNAVRFLFWTAEEFGLLGSE
YYTSHLDADELAKIRLYLNFDMIASPNYALMIYDGDGDAFNQTGPAGSAQIEALFEKYFRSKKLPYVPTEFNGRS
DYEGFISRGIPAGGLFTGAEGLKTEAEAKLFGGQANVSYDVNYHAVGDNFKNLNHEAFLINSKATAFAVAKYANS
LASIPRRSATDKREVKKREPRAHAHTAETGCFHSLVEI*
Coding >Pro_DTO377G3_2|g5435.t1
ATGAAGTGGCTTTTCTTGATAACCCTGTCCGTGGGCCTGGCTGAAGCTGGCCGGAGGAAGCCCCTTGTTTCACCG
AATGACTTTCCCTCTACCATTCGACTGAAAGACCTCCTGAAGGGCACCCAACAGCTTGAGGATTTCGCCTATGCG
TACCCCGAGCGTAATCGCGTCTTTGGCAGTGCAGCACACAACGATACTGTTGACTTCATCTATCGCGAGTTGAAG
AAGACCGGCTATTACAATGTGTGGAAGCAGCCGCAGGTGCACACATGGACTACTGCAAATACCTCGCTGACGCTT
GAGGGCGAGTCTATCAAAGCATCGGCCATGACCTACAGTCCTAGCGTGGAGGTTACTGCAGAGCTGGCAGTGGTC
TCGAATCTCGGATGCAGTGCATCAGACTACCCGAGTGACGTGGCTGGTGCAATTGCCCTAGTCCAGCGTGGAGAA
TGCACTTTCGCAGAAAAGTCGTTACTTGCTGCTGCTGCCAATGCCGCTGCGGTAATTGTCTATAACAACGTTGCA
GGGTCTCTTAGTGGAACCCTGGGTGGCGTATCCAGTGATTATTCCGCCATCGCGGGAGTTTCTGATGTCGACGGC
AAGGTCCTGCTCAGTGCAGCAGAGAAGGGCGCTGTGACTGTGTCTCTTTTACTGGACAGCCGGGTCGAGAATCGC
ACTACATTCAACGTAATTGCAGAGACAAAGGGCGGTGATCACAATAACGTCGTCTCACTGGGAGGTCACACCGAC
TCAGTCGATGCCGGCCCAGGCATCAATGATGATGGCTCTGGAATCATTAGCAACCTCGTGGTGGCAAAGGCGTTG
ACGCGATTCTCTGTCAAGAATGCCGTGAGATTCCTCTTCTGGACGGCTGAGGAGTTCGGCCTGTTGGGTAGCGAG
TATTACACCTCCCACCTGGACGCAGATGAACTAGCAAAAATCAGACTCTACCTCAACTTCGATATGATTGCCTCG
CCCAACTATGCGCTCATGATCTACGATGGTGACGGAGATGCCTTCAACCAGACTGGACCAGCGGGATCTGCCCAG
ATTGAGGCTTTGTTTGAGAAATATTTCAGGTCAAAGAAGCTGCCCTATGTTCCTACTGAGTTTAATGGCCGATCC
GACTACGAGGGTTTCATCTCTCGTGGAATTCCCGCCGGTGGACTTTTCACTGGCGCTGAAGGCCTCAAGACCGAA
GCAGAGGCAAAACTGTTCGGAGGCCAAGCAAACGTATCCTACGATGTGAATTACCATGCTGTCGGGGACAACTTC
AAGAATCTCAACCACGAAGCATTCCTGATTAATTCGAAGGCTACCGCTTTCGCTGTTGCTAAATATGCTAATAGC
CTTGCTTCGATCCCCCGACGGAGTGCAACCGACAAGCGAGAGGTCAAGAAAAGGGAGCCTCGGGCGCATGCACAC
ACCGCGGAGACCGGATGTTTCCATTCCCTGGTCGAAATTTGA
Transcript >Pro_DTO377G3_2|g5435.t1
ATGAAGTGGCTTTTCTTGATAACCCTGTCCGTGGGCCTGGCTGAAGCTGGCCGGAGGAAGCCCCTTGTTTCACCG
AATGACTTTCCCTCTACCATTCGACTGAAAGACCTCCTGAAGGGCACCCAACAGCTTGAGGATTTCGCCTATGCG
TACCCCGAGCGTAATCGCGTCTTTGGCAGTGCAGCACACAACGATACTGTTGACTTCATCTATCGCGAGTTGAAG
AAGACCGGCTATTACAATGTGTGGAAGCAGCCGCAGGTGCACACATGGACTACTGCAAATACCTCGCTGACGCTT
GAGGGCGAGTCTATCAAAGCATCGGCCATGACCTACAGTCCTAGCGTGGAGGTTACTGCAGAGCTGGCAGTGGTC
TCGAATCTCGGATGCAGTGCATCAGACTACCCGAGTGACGTGGCTGGTGCAATTGCCCTAGTCCAGCGTGGAGAA
TGCACTTTCGCAGAAAAGTCGTTACTTGCTGCTGCTGCCAATGCCGCTGCGGTAATTGTCTATAACAACGTTGCA
GGGTCTCTTAGTGGAACCCTGGGTGGCGTATCCAGTGATTATTCCGCCATCGCGGGAGTTTCTGATGTCGACGGC
AAGGTCCTGCTCAGTGCAGCAGAGAAGGGCGCTGTGACTGTGTCTCTTTTACTGGACAGCCGGGTCGAGAATCGC
ACTACATTCAACGTAATTGCAGAGACAAAGGGCGGTGATCACAATAACGTCGTCTCACTGGGAGGTCACACCGAC
TCAGTCGATGCCGGCCCAGGCATCAATGATGATGGCTCTGGAATCATTAGCAACCTCGTGGTGGCAAAGGCGTTG
ACGCGATTCTCTGTCAAGAATGCCGTGAGATTCCTCTTCTGGACGGCTGAGGAGTTCGGCCTGTTGGGTAGCGAG
TATTACACCTCCCACCTGGACGCAGATGAACTAGCAAAAATCAGACTCTACCTCAACTTCGATATGATTGCCTCG
CCCAACTATGCGCTCATGATCTACGATGGTGACGGAGATGCCTTCAACCAGACTGGACCAGCGGGATCTGCCCAG
ATTGAGGCTTTGTTTGAGAAATATTTCAGGTCAAAGAAGCTGCCCTATGTTCCTACTGAGTTTAATGGCCGATCC
GACTACGAGGGTTTCATCTCTCGTGGAATTCCCGCCGGTGGACTTTTCACTGGCGCTGAAGGCCTCAAGACCGAA
GCAGAGGCAAAACTGTTCGGAGGCCAAGCAAACGTATCCTACGATGTGAATTACCATGCTGTCGGGGACAACTTC
AAGAATCTCAACCACGAAGCATTCCTGATTAATTCGAAGGCTACCGCTTTCGCTGTTGCTAAATATGCTAATAGC
CTTGCTTCGATCCCCCGACGGAGTGCAACCGACAAGCGAGAGGTCAAGAAAAGGGAGCCTCGGGCGCATGCACAC
ACCGCGGAGACCGGATGTTTCCATTCCCTGGTCGAAATTTGA
Gene >Pro_DTO377G3_2|g5435.t1
ATGAAGTGGCTTTTCTTGATAACCCTGTCCGTGGGCCTGGCTGAAGCTGGCCGGAGGAAGCCCCTTGTTTCACCG
GTATGTATACATGTTGGATCTCCGCCGTCGTTTAGGTAATCTGACTTATTAGAATGACTTTCCCTCTACCATTCG
ACTGAAAGACCTCCTGAAGGGCACCCAACAGCTTGAGGATTTCGCCTATGCGTACCCCGAGCGTAATCGCGTCTT
TGGCAGTGCAGCACACAACGATACTGTTGACTTCATCTATCGCGAGTTGAAGAAGACCGGCTATTACAATGTGTG
GAAGCAGCCGCAGGTGCACACATGGACTACTGCAAATACCTCGCTGACGCTTGAGGGCGAGTCTATCAAAGCATC
GGCCATGACCTACAGTCCTAGCGTGGAGGTTACTGCAGAGCTGGCAGTGGTCTCGAATCTCGGATGCAGTGCATC
AGACTACCCGAGTGACGTGGCTGGTGCAATTGCCCTAGTCCAGCGTGGAGAATGCACTTTCGCAGAAAAGTCGTT
ACTTGCTGCTGCTGCCAATGCCGCTGCGGTAATTGTCTATAACAACGTTGCAGGGTCTCTTAGTGGAACCCTGGG
TGGCGTATCCAGTGATTATTCCGCCATCGCGGGAGTTTCTGATGTCGACGGCAAGGTCCTGCTCAGTGCAGCAGA
GAAGGGCGCTGTGACTGTGTCTCTTTTACTGGACAGCCGGGTCGAGAATCGCACTACATTCAACGTAATTGCAGA
GACAAAGGGCGGTGATCACAATAACGTCGTCTCACTGGGAGGTCACACCGACTCAGTCGATGCCGGCCCAGGCAT
CAATGATGATGGCTCTGGAATCATTAGCAACCTCGTGGTGGCAAAGGCGTTGACGCGATTCTCTGTCAAGAATGC
CGTGAGATTCCTCTTCTGGACGGCTGAGGAGTTCGGCCTGTTGGGTAGCGAGTATTACACCTCCCACCTGGACGC
AGATGAACTAGCAAAAATCAGACTCTACCTCAACTTCGATATGATTGCCTCGCCCAACTATGCGCTCATGATCTA
CGATGGTGACGGAGATGCCTTCAACCAGACTGGACCAGCGGGATCTGCCCAGATTGAGGCTTTGTTTGAGAAATA
TTTCAGGTCAAAGAAGCTGCCCTATGTTCCTACTGAGTTTAATGGCCGATCCGACTACGAGGGTTTCATCTCTCG
TGGAATTCCCGCCGGTGGACTTTTCACTGGCGCTGAAGGCCTCAAGACCGAAGCAGAGGCAAAACTGTTCGGAGG
CCAAGCAAACGTATCCTACGATGTGAATTACCATGCTGTCGGGGACAACTTCAAGAATCTCAACCACGAAGCATT
CCTGATTAATTCGAAGGCTACCGCTTTCGCTGTTGCTAAATATGCTAATAGCCTTGCTTCGATCCCCCGACGGAG
TGCAACCGACAAGCGAGAGGTCAAGAAAAGGGAGCCTCGGGCGCATGCACACACCGCGGAGACCGGATGTTTCCA
TTCCCTGGTCGAAATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail