Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5416.t1
Gene name
Locationscaffold_13:25526..26373
Strand+
Gene length (bp)847
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06246 Isy1 Isy1-like splicing family 1.4E-82 1 248

GO

GO Term Description Terminal node
GO:0000350 generation of catalytic spliceosome for second transesterification step Yes
GO:0022618 ribonucleoprotein complex assembly No
GO:0008150 biological_process No
GO:0043933 protein-containing complex organization No
GO:0009987 cellular process No
GO:0016043 cellular component organization No
GO:0065003 protein-containing complex assembly No
GO:0071826 ribonucleoprotein complex subunit organization No
GO:0071840 cellular component organization or biogenesis No
GO:0022607 cellular component assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5416.t1
MARNSEKAQSMLFRFRAQQAADLGIIDVSRTRRPKAITSIDTVPVCERWRGQVVKEISRKVSRIHVQSLSDYQIR
DLNDEINKLMREKWAWEMQIRNLGGPNYMRGSNRLYDDEGREIPGGGRGYKYYGRARELPGVKEMIEAAVTRAKG
PAEEEAVSGRGGDIATRKVDANYFGYGLDEEDGTLLAYEKQKEKESVEHLRHQGEDDAEDGWQSLPGDAGDGVEW
RLPTLDEVQEELVDRRRRRLLDKIS*
Coding >Pro_DTO377G3_2|g5416.t1
ATGGCACGCAACAGTGAAAAAGCGCAGTCTATGCTGTTCCGCTTCCGCGCGCAGCAAGCAGCCGACCTCGGAATC
ATTGATGTCTCACGCACCCGACGGCCCAAAGCGATCACGTCCATCGATACGGTGCCAGTATGCGAGCGCTGGCGC
GGACAGGTCGTCAAAGAAATTTCGCGCAAAGTATCACGCATCCACGTGCAAAGCCTGAGCGACTACCAGATCCGC
GATCTCAACGATGAGATTAACAAGCTCATGCGTGAGAAATGGGCGTGGGAAATGCAAATCCGCAACCTCGGCGGA
CCGAACTACATGCGTGGATCGAACCGACTTTACGACGATGAAGGACGCGAGATCCCCGGCGGAGGAAGAGGCTAC
AAATATTATGGTCGTGCCCGGGAGCTGCCTGGTGTCAAAGAAATGATTGAGGCTGCGGTTACTCGCGCGAAAGGA
CCGGCGGAGGAAGAGGCTGTGTCTGGCCGCGGTGGAGATATTGCGACGAGGAAGGTTGATGCCAACTACTTCGGC
TATGGTCTCGATGAAGAAGATGGTACGTTATTGGCGTATGAGAAACAGAAGGAGAAGGAGTCTGTTGAACACCTG
CGCCACCAAGGAGAGGATGATGCTGAAGATGGCTGGCAATCTCTACCTGGTGATGCGGGCGACGGGGTGGAATGG
AGACTCCCGACGCTGGATGAGGTCCAGGAAGAGCTTGTGGATAGGCGGCGCCGCCGCCTTCTGGACAAGATCTCT
TGA
Transcript >Pro_DTO377G3_2|g5416.t1
ATGGCACGCAACAGTGAAAAAGCGCAGTCTATGCTGTTCCGCTTCCGCGCGCAGCAAGCAGCCGACCTCGGAATC
ATTGATGTCTCACGCACCCGACGGCCCAAAGCGATCACGTCCATCGATACGGTGCCAGTATGCGAGCGCTGGCGC
GGACAGGTCGTCAAAGAAATTTCGCGCAAAGTATCACGCATCCACGTGCAAAGCCTGAGCGACTACCAGATCCGC
GATCTCAACGATGAGATTAACAAGCTCATGCGTGAGAAATGGGCGTGGGAAATGCAAATCCGCAACCTCGGCGGA
CCGAACTACATGCGTGGATCGAACCGACTTTACGACGATGAAGGACGCGAGATCCCCGGCGGAGGAAGAGGCTAC
AAATATTATGGTCGTGCCCGGGAGCTGCCTGGTGTCAAAGAAATGATTGAGGCTGCGGTTACTCGCGCGAAAGGA
CCGGCGGAGGAAGAGGCTGTGTCTGGCCGCGGTGGAGATATTGCGACGAGGAAGGTTGATGCCAACTACTTCGGC
TATGGTCTCGATGAAGAAGATGGTACGTTATTGGCGTATGAGAAACAGAAGGAGAAGGAGTCTGTTGAACACCTG
CGCCACCAAGGAGAGGATGATGCTGAAGATGGCTGGCAATCTCTACCTGGTGATGCGGGCGACGGGGTGGAATGG
AGACTCCCGACGCTGGATGAGGTCCAGGAAGAGCTTGTGGATAGGCGGCGCCGCCGCCTTCTGGACAAGATCTCT
TGA
Gene >Pro_DTO377G3_2|g5416.t1
ATGGTGAGACTCACACTTATCAGCTCAAATCCACGGGGAAATCCCCATATCCATGTCGAGTCACGTCTTGCTAAT
TCAAGCCCCCGCTATATAATAGGCACGCAACAGTGAAAAAGCGCAGTCTATGCTGTTCCGCTTCCGCGCGCAGCA
AGCAGCCGACCTCGGAATCATTGATGTCTCACGCACCCGACGGCCCAAAGCGATCACGTCCATCGATACGGTGCC
AGTATGCGAGCGCTGGCGCGGACAGGTCGTCAAAGAAATTTCGCGCAAAGTATCACGCATCCACGTGCAAAGCCT
GAGCGACTACCAGATCCGCGATCTCAACGATGAGATTAACAAGCTCATGCGTGAGAAATGGGCGTGGGAAATGCA
AATCCGCAACCTCGGCGGACCGAACTACATGCGTGGATCGAACCGACTTTACGACGATGAAGGACGCGAGATCCC
CGGCGGAGGAAGAGGCTACAAATATTATGGTCGTGCCCGGGAGCTGCCTGGTGTCAAAGAAATGATTGAGGCTGC
GGTTACTCGCGCGAAAGGACCGGCGGAGGAAGAGGCTGTGTCTGGCCGCGGTGGAGATATTGCGACGAGGAAGGT
TGATGCCAACTACTTCGGCTATGGTCTCGATGAAGAAGATGGTACGTTATTGGCGTATGAGAAACAGAAGGAGAA
GGAGTCTGTTGAACACCTGCGCCACCAAGGAGAGGATGATGCTGAAGATGGCTGGCAATCTCTACCTGGTGATGC
GGGCGACGGGGTGGAATGGAGACTCCCGACGCTGGATGAGGTCCAGGAAGAGCTTGTGGATAGGCGGCGCCGCCG
CCTTCTGGACAAGATCTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail