Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5411.t1
Gene name
Locationscaffold_13:11679..13048
Strand+
Gene length (bp)1369
Transcript length (bp)1233
Coding sequence length (bp)1233
Protein length (aa) 411

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 3.0E-32 120 390

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 58 80 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 2.88 0.62 5.14
5d_25C Five days - 25 degrees Celsius 2.34 0.45 4.23
7d_25C Seven days - 25 degrees Celsius 1.85 0.22 3.48
10d_25C Ten days - 25 degrees Celsius 0.89 0.00 1.83
7d_15C Seven days - 15 degrees Celsius 8.55 3.14 13.96
7d_30C Seven days - 30 degrees Celsius 2.84 0.51 5.18

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.723264 no
3d_25C 7d_25C 0.411808 no
3d_25C 7d_15C 0.005626 yes
3d_25C 7d_30C 0.986847 no
3d_25C 10d_25C 0.040199 yes
5d_25C 7d_25C 0.704313 no
5d_25C 7d_15C 0.000700 yes
5d_25C 7d_30C 0.748449 no
5d_25C 10d_25C 0.091757 no
7d_25C 7d_15C 0.001278 yes
7d_25C 7d_30C 0.440515 no
7d_25C 10d_25C 0.229901 no
7d_15C 7d_30C 0.008807 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.043201 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5411.t1
MATAVPEKYVVPAVVQSIVVSEIPGSSIKSSLDSTVGARAEKGEKKNFFTRPWGRRQIGILCVLGFFGLALTALV
IVLPIYFTKIYGFAKDTDNYWRLPQPNEDHSYYLEENRPVFALVNFPDPGLIQHNGTWYAYGTNPKKKNPHTIHV
PVATSTDFINWTLHEDYDAMPTLGTWEKKVNHWAPDVIQRDDGKFVMYYSGEAENYGSHHCVGVAVSTGTSPLGP
YIPEDKPLACPHKHGGAIDPSPFRDTDGTLYVVYKGDGNSVGRGGNCNNSKKPVVSVPILLQELKSDGITSVGEP
VKILDIDDTDGPLVEAPDILLTEDGTYYLFFSSHCYVSLGYNVKYAHSKTPKGPYIRADRPLLQTGDWGLEAPGG
ATVSTDGSKIVFHANCGIFRCVEFYENYGNTREPD*
Coding >Pro_DTO377G3_2|g5411.t1
ATGGCGACTGCTGTACCTGAAAAATACGTGGTTCCCGCTGTCGTCCAGTCCATCGTAGTTAGTGAAATCCCAGGC
AGCAGCATTAAATCTTCCTTGGATTCGACAGTGGGAGCCAGAGCAGAAAAGGGAGAAAAAAAAAACTTTTTTACT
CGACCATGGGGACGACGTCAGATTGGGATACTCTGCGTTCTGGGGTTCTTCGGATTGGCCTTAACAGCACTCGTC
ATTGTCCTCCCCATTTATTTCACTAAGATCTACGGCTTTGCGAAAGACACTGATAACTACTGGAGACTACCCCAG
CCAAATGAAGACCACAGCTACTACCTCGAGGAGAATCGACCTGTCTTCGCCCTCGTCAATTTCCCGGACCCGGGC
CTCATTCAACACAATGGCACATGGTATGCCTACGGGACCAATCCCAAGAAAAAGAACCCCCACACTATCCATGTA
CCCGTTGCCACATCGACCGATTTTATTAACTGGACTCTTCACGAGGATTACGACGCGATGCCGACTCTTGGCACT
TGGGAGAAGAAGGTCAATCATTGGGCTCCGGATGTGATTCAGCGCGACGACGGCAAATTTGTCATGTATTACTCA
GGAGAAGCCGAGAATTACGGGAGCCACCATTGCGTGGGAGTTGCTGTATCAACCGGCACGAGCCCACTAGGCCCT
TACATCCCCGAAGACAAGCCACTAGCCTGTCCACACAAGCATGGCGGTGCTATCGACCCCTCACCGTTCAGGGAC
ACCGACGGCACGCTGTACGTGGTCTACAAGGGCGACGGAAACAGCGTTGGACGCGGCGGCAACTGCAACAACAGC
AAGAAGCCAGTTGTATCCGTTCCGATTCTCCTACAGGAGCTGAAGAGCGATGGTATCACATCCGTCGGGGAGCCA
GTGAAAATTCTCGATATTGACGATACAGATGGTCCCCTGGTTGAGGCTCCTGATATCTTGCTCACCGAGGACGGC
ACCTACTATCTGTTCTTTTCTTCGCATTGCTATGTCTCGCTGGGCTACAATGTGAAATACGCACACTCGAAAACC
CCCAAGGGTCCGTACATCCGGGCTGATCGGCCTTTGCTGCAGACTGGTGATTGGGGGCTCGAGGCGCCTGGTGGT
GCGACGGTTTCGACTGATGGGAGCAAGATTGTTTTCCATGCCAATTGCGGTATATTCCGGTGCGTCGAATTCTAC
GAAAACTACGGGAACACTCGTGAGCCGGACTAG
Transcript >Pro_DTO377G3_2|g5411.t1
ATGGCGACTGCTGTACCTGAAAAATACGTGGTTCCCGCTGTCGTCCAGTCCATCGTAGTTAGTGAAATCCCAGGC
AGCAGCATTAAATCTTCCTTGGATTCGACAGTGGGAGCCAGAGCAGAAAAGGGAGAAAAAAAAAACTTTTTTACT
CGACCATGGGGACGACGTCAGATTGGGATACTCTGCGTTCTGGGGTTCTTCGGATTGGCCTTAACAGCACTCGTC
ATTGTCCTCCCCATTTATTTCACTAAGATCTACGGCTTTGCGAAAGACACTGATAACTACTGGAGACTACCCCAG
CCAAATGAAGACCACAGCTACTACCTCGAGGAGAATCGACCTGTCTTCGCCCTCGTCAATTTCCCGGACCCGGGC
CTCATTCAACACAATGGCACATGGTATGCCTACGGGACCAATCCCAAGAAAAAGAACCCCCACACTATCCATGTA
CCCGTTGCCACATCGACCGATTTTATTAACTGGACTCTTCACGAGGATTACGACGCGATGCCGACTCTTGGCACT
TGGGAGAAGAAGGTCAATCATTGGGCTCCGGATGTGATTCAGCGCGACGACGGCAAATTTGTCATGTATTACTCA
GGAGAAGCCGAGAATTACGGGAGCCACCATTGCGTGGGAGTTGCTGTATCAACCGGCACGAGCCCACTAGGCCCT
TACATCCCCGAAGACAAGCCACTAGCCTGTCCACACAAGCATGGCGGTGCTATCGACCCCTCACCGTTCAGGGAC
ACCGACGGCACGCTGTACGTGGTCTACAAGGGCGACGGAAACAGCGTTGGACGCGGCGGCAACTGCAACAACAGC
AAGAAGCCAGTTGTATCCGTTCCGATTCTCCTACAGGAGCTGAAGAGCGATGGTATCACATCCGTCGGGGAGCCA
GTGAAAATTCTCGATATTGACGATACAGATGGTCCCCTGGTTGAGGCTCCTGATATCTTGCTCACCGAGGACGGC
ACCTACTATCTGTTCTTTTCTTCGCATTGCTATGTCTCGCTGGGCTACAATGTGAAATACGCACACTCGAAAACC
CCCAAGGGTCCGTACATCCGGGCTGATCGGCCTTTGCTGCAGACTGGTGATTGGGGGCTCGAGGCGCCTGGTGGT
GCGACGGTTTCGACTGATGGGAGCAAGATTGTTTTCCATGCCAATTGCGGTATATTCCGGTGCGTCGAATTCTAC
GAAAACTACGGGAACACTCGTGAGCCGGACTAG
Gene >Pro_DTO377G3_2|g5411.t1
ATGGCGACTGCTGTACCTGAAAAATACGTGGTTCCCGCTGTCGTCCAGTCCATCGTAGTTAGTGAAATCCCAGGC
AGCAGCATTAAATCTTCCTTGGATTCGACAGTGGGAGCCAGAGCAGAAAAGGGAGAAAAAAAAAACTTTTTTACT
CGACCATGGGGACGACGTCAGATTGGGATACTCTGCGTTCTGGGGTTCTTCGGATTGGCCTTAACAGCACTCGTC
ATTGTCCTCCCCATTTATTTCACTAAGATCTACGGCTTTGCGAAAGACACTGATAACTACTGGAGACTACCCCAG
CCAAATGAAGACCACAGCTACTACCTCGAGGAGAATCGACCTGTCTTCGCCCTCGTCAATTTCCCGGACCCGGGC
CTCATTCAACACAATGGCACATGGTATGCCTACGGGACCAATCCCAAGAAAAAGAACCCCCACACTATCCATGTA
CCCGTTGCCACATCGACCGATTTTATTAACTGGACTCTTCACGAGGATTACGACGCGATGCCGACTCTTGGCACT
TGGGAGAAGAAGGTCAATCATTGGGCTCCGGATGTGATTCAGCGCGTAAGTATACCAATGAGCATTAGCTCCTAT
CCAGTCTCTGATATTCATATATGAACTTTTAGGACGACGGCAAATTTGTCATGTATTACTCAGGAGAAGCCGAGA
ATTACGGGAGCCACCATTGCGTGGGAGTTGCTGTATCAACCGGCACGAGCCCACTAGGCCCTTACATCCCCGAAG
ACAAGCCACTAGCCTGTCCACACAAGCATGGCGGTGCTATCGACCCCTCACCGTTCAGGGACACCGACGGCACGC
TGTACGTGGTCTACAAGGGCGACGGAAACAGCGTTGGACGCGGCGGCAACTGCAACAACAGCAAGAAGCCAGTTG
TATCCGTTCCGATTCTCCTACAGGAGCTGAAGAGCGATGGTATCACATCCGTCGGGGAGCCAGTGAAAATTCTCG
ATATTGACGATACAGATGGTCCCCTGGTTGAGGCTCCTGATATCTTGCTCACCGAGGACGGCACCTACTATCTGT
TCTTTTCTTCGCATTGCTATGTCTCGCTGGGCTACAATGTGAAATACGCACACTCGAAAACCCCCAAGGGTCCGT
ACATCCGGGCTGATCGGCCTTTGCTGCAGACTGGTGATTGGGGGCTCGAGGCGCCTGGTGGTGCGACGGTTTCGA
CTGATGGGAGCAAGATTGTTTTCCATGCCAATTGCGGTATATTCCGGTGTATGTGGTCTGCTGCTATTGATATTC
GATCTAATAACAACACGATTGTTATGTCGAAACTCGTGCTTGGCCAGGCGTCGAATTCTACGAAAACTACGGGAA
CACTCGTGAGCCGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail