Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5394.t1
Gene name
Locationscaffold_12:655762..657553
Strand+
Gene length (bp)1791
Transcript length (bp)1677
Coding sequence length (bp)1677
Protein length (aa) 559

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00262 Calreticulin Calreticulin family 6.9E-172 47 413

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0006457 protein folding Yes
GO:0005783 endoplasmic reticulum Yes
GO:0051082 unfolded protein binding Yes
GO:0046872 metal ion binding No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No
GO:0005515 protein binding No
GO:0043231 intracellular membrane-bounded organelle No
GO:0009987 cellular process No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043227 membrane-bounded organelle No
GO:0008150 biological_process No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 490 512 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5394.t1
MRFNTALTSALVSSASLMGYAHAEEETADTTVIEKPTFTPTSLKAPFLEQFTDDWESRWKPSHAKKDDKSEDEWA
YVGEWAVEEPSVFKGIEGDKGLVVKNAAAHHAISAKFPNKIDNKGKTLVVQYEVKPQNSLVCGGAYLKLLQENKK
LHQEEFSNATPYVIMFGPDKCGATNKVHFIFRHKNPKTGEYEEKHLKTPPVARTNKVTSLYTLIVNPDQTFEILI
NGDSAKNGSLLEDFNPPVNPEKEIDDPKDSKPADWVDEIKIADPEATKPADWDEDAPFEILDEEATQPADWLEDE
PESIPDPEAEKPEDWDDEEDGDWLAPTVPNPKCAEVSGCGPWTRPLIKNPEYKGKWEAPLIDNPAYKGVWAPRKI
KNPAYFEDKTPSNLEPMGAIGFEIWTMQNDILFDNLYIGHSIEDAEKLRQETFDVKFPIEEAEEEASKPKPEVKQ
EDTTVTFQEDPVAFVRQKVNHFVDLAKEDPINAVKTLPEVAGGLGALLLTMILIIVGAIGASSPAAPTEKKGKQP
AGAPKEKKEEAVTSSAETSKGGATKRTTRSSAE*
Coding >Pro_DTO377G3_2|g5394.t1
ATGCGCTTTAACACTGCGTTGACATCTGCTCTGGTCTCCTCCGCCAGCCTCATGGGCTACGCCCATGCGGAGGAG
GAGACTGCGGATACCACCGTCATTGAAAAGCCTACCTTCACTCCTACTAGCCTTAAAGCTCCTTTCCTGGAGCAA
TTCACAGACGACTGGGAGTCTCGGTGGAAGCCTTCTCACGCAAAGAAGGATGACAAGTCTGAGGATGAGTGGGCT
TACGTTGGTGAATGGGCAGTTGAGGAGCCCTCCGTCTTCAAGGGTATCGAGGGAGACAAGGGTCTGGTCGTGAAG
AACGCTGCTGCCCACCATGCCATCTCCGCCAAGTTCCCGAATAAGATTGACAACAAGGGCAAGACCCTGGTGGTT
CAGTACGAGGTCAAGCCGCAAAACTCCCTGGTTTGCGGCGGTGCCTACCTTAAGCTTCTCCAAGAGAACAAGAAG
CTCCACCAGGAGGAGTTCTCCAACGCCACTCCCTATGTCATCATGTTCGGACCTGACAAGTGCGGTGCCACTAAT
AAGGTTCACTTCATCTTCCGCCACAAGAACCCCAAGACCGGCGAGTACGAAGAGAAGCACCTCAAGACTCCTCCC
GTGGCCCGCACCAACAAGGTCACCTCCCTCTACACCCTGATCGTCAACCCCGATCAGACCTTTGAGATCCTGATC
AATGGCGACTCTGCCAAGAACGGTAGCCTCCTCGAGGACTTCAACCCTCCCGTCAACCCTGAGAAGGAGATTGAT
GATCCCAAGGACTCTAAGCCCGCCGACTGGGTCGATGAGATTAAGATCGCCGACCCCGAAGCCACCAAGCCCGCC
GACTGGGATGAAGATGCTCCTTTCGAGATCCTCGATGAGGAGGCCACCCAGCCCGCCGACTGGCTGGAGGATGAG
CCCGAGAGTATCCCCGACCCCGAGGCTGAGAAGCCCGAGGATTGGGATGACGAGGAGGATGGAGACTGGCTCGCT
CCCACTGTCCCTAACCCCAAGTGTGCCGAAGTCTCTGGCTGTGGCCCTTGGACCCGCCCTCTGATCAAGAACCCC
GAGTACAAGGGCAAGTGGGAGGCCCCTCTCATCGACAACCCTGCCTACAAGGGTGTCTGGGCCCCCCGTAAGATC
AAGAACCCCGCCTACTTTGAGGATAAGACTCCATCCAACCTTGAGCCCATGGGCGCTATTGGCTTCGAAATCTGG
ACCATGCAGAATGATATTCTGTTCGACAACCTCTACATTGGTCACTCCATTGAGGATGCTGAGAAGCTCCGCCAG
GAGACCTTCGATGTCAAGTTCCCCATCGAGGAGGCTGAGGAGGAGGCTTCTAAGCCCAAGCCCGAGGTCAAGCAA
GAGGATACCACTGTCACCTTCCAGGAGGATCCTGTTGCCTTTGTCCGCCAGAAGGTCAACCACTTCGTTGATCTG
GCCAAGGAGGACCCCATCAACGCTGTCAAGACCCTCCCTGAGGTGGCTGGTGGCCTGGGTGCGCTCCTCTTGACT
ATGATCCTCATCATTGTGGGTGCCATTGGTGCTAGCAGCCCTGCCGCCCCGACCGAGAAGAAGGGCAAGCAGCCC
GCCGGTGCTCCCAAGGAGAAGAAGGAAGAGGCTGTCACCTCCTCCGCTGAGACTAGCAAGGGCGGTGCCACCAAG
CGCACCACCCGATCCTCGGCCGAGTAA
Transcript >Pro_DTO377G3_2|g5394.t1
ATGCGCTTTAACACTGCGTTGACATCTGCTCTGGTCTCCTCCGCCAGCCTCATGGGCTACGCCCATGCGGAGGAG
GAGACTGCGGATACCACCGTCATTGAAAAGCCTACCTTCACTCCTACTAGCCTTAAAGCTCCTTTCCTGGAGCAA
TTCACAGACGACTGGGAGTCTCGGTGGAAGCCTTCTCACGCAAAGAAGGATGACAAGTCTGAGGATGAGTGGGCT
TACGTTGGTGAATGGGCAGTTGAGGAGCCCTCCGTCTTCAAGGGTATCGAGGGAGACAAGGGTCTGGTCGTGAAG
AACGCTGCTGCCCACCATGCCATCTCCGCCAAGTTCCCGAATAAGATTGACAACAAGGGCAAGACCCTGGTGGTT
CAGTACGAGGTCAAGCCGCAAAACTCCCTGGTTTGCGGCGGTGCCTACCTTAAGCTTCTCCAAGAGAACAAGAAG
CTCCACCAGGAGGAGTTCTCCAACGCCACTCCCTATGTCATCATGTTCGGACCTGACAAGTGCGGTGCCACTAAT
AAGGTTCACTTCATCTTCCGCCACAAGAACCCCAAGACCGGCGAGTACGAAGAGAAGCACCTCAAGACTCCTCCC
GTGGCCCGCACCAACAAGGTCACCTCCCTCTACACCCTGATCGTCAACCCCGATCAGACCTTTGAGATCCTGATC
AATGGCGACTCTGCCAAGAACGGTAGCCTCCTCGAGGACTTCAACCCTCCCGTCAACCCTGAGAAGGAGATTGAT
GATCCCAAGGACTCTAAGCCCGCCGACTGGGTCGATGAGATTAAGATCGCCGACCCCGAAGCCACCAAGCCCGCC
GACTGGGATGAAGATGCTCCTTTCGAGATCCTCGATGAGGAGGCCACCCAGCCCGCCGACTGGCTGGAGGATGAG
CCCGAGAGTATCCCCGACCCCGAGGCTGAGAAGCCCGAGGATTGGGATGACGAGGAGGATGGAGACTGGCTCGCT
CCCACTGTCCCTAACCCCAAGTGTGCCGAAGTCTCTGGCTGTGGCCCTTGGACCCGCCCTCTGATCAAGAACCCC
GAGTACAAGGGCAAGTGGGAGGCCCCTCTCATCGACAACCCTGCCTACAAGGGTGTCTGGGCCCCCCGTAAGATC
AAGAACCCCGCCTACTTTGAGGATAAGACTCCATCCAACCTTGAGCCCATGGGCGCTATTGGCTTCGAAATCTGG
ACCATGCAGAATGATATTCTGTTCGACAACCTCTACATTGGTCACTCCATTGAGGATGCTGAGAAGCTCCGCCAG
GAGACCTTCGATGTCAAGTTCCCCATCGAGGAGGCTGAGGAGGAGGCTTCTAAGCCCAAGCCCGAGGTCAAGCAA
GAGGATACCACTGTCACCTTCCAGGAGGATCCTGTTGCCTTTGTCCGCCAGAAGGTCAACCACTTCGTTGATCTG
GCCAAGGAGGACCCCATCAACGCTGTCAAGACCCTCCCTGAGGTGGCTGGTGGCCTGGGTGCGCTCCTCTTGACT
ATGATCCTCATCATTGTGGGTGCCATTGGTGCTAGCAGCCCTGCCGCCCCGACCGAGAAGAAGGGCAAGCAGCCC
GCCGGTGCTCCCAAGGAGAAGAAGGAAGAGGCTGTCACCTCCTCCGCTGAGACTAGCAAGGGCGGTGCCACCAAG
CGCACCACCCGATCCTCGGCCGAGTAA
Gene >Pro_DTO377G3_2|g5394.t1
ATGCGCTTTAACACTGCGTTGACATCTGCTCTGGTCTCCTCCGCCAGCCTCATGGGCTACGCCCATGCGGAGGAG
GAGACTGCGGATACCACCGTCATTGAAAAGCCTACCTTCACTGTATGTATCTGAAACGCTCCCTCTTCGCTCACT
TTGCTAACTCCCGCAAGCCTACTAGCCTTAAAGCTCCTTTCCTGGAGCAATTCACAGACGACTGGGAGTCTCGGT
GGAAGCCTTCTCACGCAAAGAAGGATGACAAGTCTGAGGATGAGTGGGCTTACGTTGGTGAATGGGCAGTTGAGG
AGCCCTCCGTCTTCAAGGGTATCGAGGGAGACAAGGGTCTGGTCGTGAAGAACGCTGCTGCCCACCATGCCATCT
CCGCCAAGTTCCCGAATAAGATTGACAACAAGGGCAAGACCCTGGTGGTTCAGTACGAGGTCAAGCCGCAAAGTG
AGTTATGCCTTTCTACATTTGTTCGAGATCTTATATGCTGACTGGAATTGTCCTGTGTTAGACTCCCTGGTTTGC
GGCGGTGCCTACCTTAAGCTTCTCCAAGAGAACAAGAAGCTCCACCAGGAGGAGTTCTCCAACGCCACTCCCTAT
GTCATCATGTTCGGACCTGACAAGTGCGGTGCCACTAATAAGGTTCACTTCATCTTCCGCCACAAGAACCCCAAG
ACCGGCGAGTACGAAGAGAAGCACCTCAAGACTCCTCCCGTGGCCCGCACCAACAAGGTCACCTCCCTCTACACC
CTGATCGTCAACCCCGATCAGACCTTTGAGATCCTGATCAATGGCGACTCTGCCAAGAACGGTAGCCTCCTCGAG
GACTTCAACCCTCCCGTCAACCCTGAGAAGGAGATTGATGATCCCAAGGACTCTAAGCCCGCCGACTGGGTCGAT
GAGATTAAGATCGCCGACCCCGAAGCCACCAAGCCCGCCGACTGGGATGAAGATGCTCCTTTCGAGATCCTCGAT
GAGGAGGCCACCCAGCCCGCCGACTGGCTGGAGGATGAGCCCGAGAGTATCCCCGACCCCGAGGCTGAGAAGCCC
GAGGATTGGGATGACGAGGAGGATGGAGACTGGCTCGCTCCCACTGTCCCTAACCCCAAGTGTGCCGAAGTCTCT
GGCTGTGGCCCTTGGACCCGCCCTCTGATCAAGAACCCCGAGTACAAGGGCAAGTGGGAGGCCCCTCTCATCGAC
AACCCTGCCTACAAGGGTGTCTGGGCCCCCCGTAAGATCAAGAACCCCGCCTACTTTGAGGATAAGACTCCATCC
AACCTTGAGCCCATGGGCGCTATTGGCTTCGAAATCTGGACCATGCAGAATGATATTCTGTTCGACAACCTCTAC
ATTGGTCACTCCATTGAGGATGCTGAGAAGCTCCGCCAGGAGACCTTCGATGTCAAGTTCCCCATCGAGGAGGCT
GAGGAGGAGGCTTCTAAGCCCAAGCCCGAGGTCAAGCAAGAGGATACCACTGTCACCTTCCAGGAGGATCCTGTT
GCCTTTGTCCGCCAGAAGGTCAACCACTTCGTTGATCTGGCCAAGGAGGACCCCATCAACGCTGTCAAGACCCTC
CCTGAGGTGGCTGGTGGCCTGGGTGCGCTCCTCTTGACTATGATCCTCATCATTGTGGGTGCCATTGGTGCTAGC
AGCCCTGCCGCCCCGACCGAGAAGAAGGGCAAGCAGCCCGCCGGTGCTCCCAAGGAGAAGAAGGAAGAGGCTGTC
ACCTCCTCCGCTGAGACTAGCAAGGGCGGTGCCACCAAGCGCACCACCCGATCCTCGGCCGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail