Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5392.t1
Gene name
Locationscaffold_12:651506..653498
Strand-
Gene length (bp)1992
Transcript length (bp)1707
Coding sequence length (bp)1707
Protein length (aa) 569

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09325 Vps5 Vps5 C terminal like 4.4E-88 298 528
PF00787 PX PX domain 6.1E-21 199 276

GO

GO Term Description Terminal node
GO:0035091 phosphatidylinositol binding Yes
GO:0005488 binding No
GO:0008289 lipid binding No
GO:0005543 phospholipid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 69.34 42.54 96.14
5d_25C Five days - 25 degrees Celsius 69.07 42.34 95.80
7d_25C Seven days - 25 degrees Celsius 64.57 39.50 89.64
10d_25C Ten days - 25 degrees Celsius 65.28 39.95 90.61
7d_15C Seven days - 15 degrees Celsius 70.10 42.97 97.22
7d_30C Seven days - 30 degrees Celsius 59.40 36.09 82.71

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.991770 no
3d_25C 7d_25C 0.807407 no
3d_25C 7d_15C 0.976285 no
3d_25C 7d_30C 0.549360 no
3d_25C 10d_25C 0.843806 no
5d_25C 7d_25C 0.819174 no
5d_25C 7d_15C 0.965875 no
5d_25C 7d_30C 0.562150 no
5d_25C 10d_25C 0.855278 no
7d_25C 7d_15C 0.779601 no
7d_25C 7d_30C 0.778861 no
7d_25C 10d_25C 0.975331 no
7d_15C 7d_30C 0.517581 no
7d_15C 10d_25C 0.809572 no
7d_30C 10d_25C 0.744077 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5392.t1
MDLDSGDSPWGDEPSRFKHSDGPKPGAEEGAAATPASDSSPAVQTPGRRGPRGTRKINAQATKLESIDDSVDPLG
PLGEAPVEDTPTPTDEAPAPPQKEPFAGRGARPLSSPSQASGVEAADSANLEEESAVFRGPPPVQPPVQADGPKR
QTQPSMSVEQAAKPTFHIYVGDPHKVGDLTSSHIVYQVSTKTTSKAYRQPEFTVSRRYRDFLWLYNSLHSNNPGV
VVAPPPEKQAVGRFDTNFVESRRAALERMLNKIAGHPILQHDGDLKIFLESEAFTVDVKNKENREPDIGPSKGML
SSFGISVGGGTKFVEHDDWFHDRKVYLDALENQLKALLKSMDTVVIQRKGLSEAASDFSSSLHALSAVELSPALS
YPLEGLSELQLRIRELYDRQAQQDVLTLGITIDEYIRLIGSVKLAFTQRQKAFHTWHAAESDLQKRKNNQDKLLR
QGKTQQDRLNQVNADVADAERKVHQTRLLFEDMGRLMRNELQRFEKEKVEDFKSGVETFLESAVEAQKELIELWE
TFLLRLDAGEEGLPYYVPPEVSDAPAPAEPTDESGLLAAEDDA*
Coding >Pro_DTO377G3_2|g5392.t1
ATGGATCTCGATTCTGGAGATTCCCCGTGGGGCGATGAGCCTTCGCGGTTCAAGCACAGCGACGGCCCCAAGCCC
GGCGCCGAAGAAGGTGCAGCTGCAACCCCCGCGTCAGACAGCTCGCCCGCTGTCCAAACACCAGGAAGACGAGGC
CCCCGAGGGACGCGCAAGATCAACGCACAAGCCACTAAACTAGAATCCATCGATGATTCCGTCGACCCTCTCGGT
CCATTGGGAGAAGCGCCCGTCGAGGACACCCCAACACCCACAGATGAGGCACCAGCACCGCCCCAGAAAGAGCCT
TTCGCCGGACGGGGTGCACGACCACTTTCATCTCCCTCCCAGGCATCTGGAGTGGAGGCAGCAGACTCGGCCAAT
TTGGAAGAGGAGAGCGCGGTCTTCCGAGGACCCCCTCCCGTGCAACCACCGGTGCAAGCGGATGGACCGAAAAGA
CAGACGCAGCCTAGCATGAGCGTGGAGCAGGCTGCGAAGCCGACTTTCCATATCTATGTCGGAGATCCGCACAAA
GTGGGAGATCTGACAAGCAGTCATATTGTGTATCAAGTTTCGACAAAGACAACTTCTAAGGCCTATCGCCAACCC
GAGTTCACCGTTAGCCGTCGATACCGTGATTTCCTCTGGCTCTACAACTCCCTGCACAGCAATAACCCGGGAGTG
GTCGTTGCGCCTCCGCCCGAGAAGCAAGCAGTTGGCCGGTTTGATACCAACTTTGTAGAGTCGAGGAGAGCTGCC
TTGGAACGAATGCTCAACAAGATTGCCGGCCATCCTATTCTTCAACATGACGGCGATTTGAAAATTTTCCTAGAA
AGTGAAGCTTTCACCGTTGATGTTAAGAATAAGGAAAACAGAGAGCCTGATATTGGCCCAAGCAAGGGAATGCTG
AGCTCCTTTGGTATTTCTGTTGGTGGAGGAACTAAATTCGTGGAACATGACGATTGGTTCCACGACCGAAAAGTT
TACCTGGATGCATTGGAGAACCAGCTGAAGGCTCTATTGAAATCAATGGATACTGTGGTTATACAACGAAAGGGA
CTATCCGAGGCCGCAAGCGACTTTTCGAGCTCGTTGCATGCCTTATCCGCCGTCGAGCTGTCTCCCGCCCTTTCC
TACCCATTGGAAGGCCTGTCCGAACTTCAGTTGCGCATTCGGGAACTTTATGACCGACAGGCGCAGCAGGATGTT
CTGACGCTTGGAATCACGATCGATGAATATATCCGTTTAATTGGAAGTGTCAAGTTGGCTTTCACGCAGCGGCAA
AAGGCTTTCCACACCTGGCACGCAGCAGAGTCCGACCTACAGAAGCGCAAGAATAACCAAGACAAGCTACTCCGC
CAGGGAAAGACTCAGCAAGACCGCTTAAACCAAGTCAACGCCGACGTTGCAGATGCAGAGCGCAAAGTGCACCAA
ACGCGGCTGCTCTTCGAAGATATGGGTCGTCTTATGCGGAACGAACTACAACGGTTTGAGAAGGAGAAAGTGGAG
GACTTCAAGTCTGGCGTGGAAACATTCCTTGAAAGTGCAGTCGAGGCTCAGAAAGAGTTGATCGAACTCTGGGAG
ACATTCCTTCTGCGTCTAGATGCTGGCGAGGAAGGACTTCCGTATTATGTACCCCCCGAGGTGAGCGATGCACCC
GCTCCGGCAGAGCCCACAGATGAATCGGGGCTACTGGCCGCTGAGGATGACGCTTGA
Transcript >Pro_DTO377G3_2|g5392.t1
ATGGATCTCGATTCTGGAGATTCCCCGTGGGGCGATGAGCCTTCGCGGTTCAAGCACAGCGACGGCCCCAAGCCC
GGCGCCGAAGAAGGTGCAGCTGCAACCCCCGCGTCAGACAGCTCGCCCGCTGTCCAAACACCAGGAAGACGAGGC
CCCCGAGGGACGCGCAAGATCAACGCACAAGCCACTAAACTAGAATCCATCGATGATTCCGTCGACCCTCTCGGT
CCATTGGGAGAAGCGCCCGTCGAGGACACCCCAACACCCACAGATGAGGCACCAGCACCGCCCCAGAAAGAGCCT
TTCGCCGGACGGGGTGCACGACCACTTTCATCTCCCTCCCAGGCATCTGGAGTGGAGGCAGCAGACTCGGCCAAT
TTGGAAGAGGAGAGCGCGGTCTTCCGAGGACCCCCTCCCGTGCAACCACCGGTGCAAGCGGATGGACCGAAAAGA
CAGACGCAGCCTAGCATGAGCGTGGAGCAGGCTGCGAAGCCGACTTTCCATATCTATGTCGGAGATCCGCACAAA
GTGGGAGATCTGACAAGCAGTCATATTGTGTATCAAGTTTCGACAAAGACAACTTCTAAGGCCTATCGCCAACCC
GAGTTCACCGTTAGCCGTCGATACCGTGATTTCCTCTGGCTCTACAACTCCCTGCACAGCAATAACCCGGGAGTG
GTCGTTGCGCCTCCGCCCGAGAAGCAAGCAGTTGGCCGGTTTGATACCAACTTTGTAGAGTCGAGGAGAGCTGCC
TTGGAACGAATGCTCAACAAGATTGCCGGCCATCCTATTCTTCAACATGACGGCGATTTGAAAATTTTCCTAGAA
AGTGAAGCTTTCACCGTTGATGTTAAGAATAAGGAAAACAGAGAGCCTGATATTGGCCCAAGCAAGGGAATGCTG
AGCTCCTTTGGTATTTCTGTTGGTGGAGGAACTAAATTCGTGGAACATGACGATTGGTTCCACGACCGAAAAGTT
TACCTGGATGCATTGGAGAACCAGCTGAAGGCTCTATTGAAATCAATGGATACTGTGGTTATACAACGAAAGGGA
CTATCCGAGGCCGCAAGCGACTTTTCGAGCTCGTTGCATGCCTTATCCGCCGTCGAGCTGTCTCCCGCCCTTTCC
TACCCATTGGAAGGCCTGTCCGAACTTCAGTTGCGCATTCGGGAACTTTATGACCGACAGGCGCAGCAGGATGTT
CTGACGCTTGGAATCACGATCGATGAATATATCCGTTTAATTGGAAGTGTCAAGTTGGCTTTCACGCAGCGGCAA
AAGGCTTTCCACACCTGGCACGCAGCAGAGTCCGACCTACAGAAGCGCAAGAATAACCAAGACAAGCTACTCCGC
CAGGGAAAGACTCAGCAAGACCGCTTAAACCAAGTCAACGCCGACGTTGCAGATGCAGAGCGCAAAGTGCACCAA
ACGCGGCTGCTCTTCGAAGATATGGGTCGTCTTATGCGGAACGAACTACAACGGTTTGAGAAGGAGAAAGTGGAG
GACTTCAAGTCTGGCGTGGAAACATTCCTTGAAAGTGCAGTCGAGGCTCAGAAAGAGTTGATCGAACTCTGGGAG
ACATTCCTTCTGCGTCTAGATGCTGGCGAGGAAGGACTTCCGTATTATGTACCCCCCGAGGTGAGCGATGCACCC
GCTCCGGCAGAGCCCACAGATGAATCGGGGCTACTGGCCGCTGAGGATGACGCTTGA
Gene >Pro_DTO377G3_2|g5392.t1
ATGGATCTCGATTCTGGAGATTCCCCGTGGGGCGGTAGGCAATCATCATACCACAGCTCTTTGAATCGCACTCTG
ATTTATGATGCAGATGAGCCTTCGCGGTTCAAGCACAGCGACGGCCCCAAGCCCGGCGCCGAAGAAGGTGGTATG
TTTTATCTGGCTTGTCCGCTCTTTCCACGAACTTTCACTAAGCGCACTCTACCACACAGCAGCTGCAACCCCCGC
GTCAGACAGCTCGCCCGCTGTCCAAACACCAGGAAGACGAGGCCCCCGAGGGACGCGCAAGATCAACGCACAAGC
CACTAAACTAGAATCCATCGATGATTCCGTCGACCCTCTCGGTCCATTGGGAGAAGCGCCCGTCGAGGACACCCC
AACACCCACAGATGAGGCACCAGCACCGCCCCAGAAAGAGCCTTTCGCCGGACGGGGTGCACGACCACTTTCATC
TCCCTCCCAGGCATCTGGAGTGGAGGCAGCAGACTCGGCCAATTTGGAAGAGGAGAGCGCGGTCTTCCGAGGACC
CCCTCCCGTGCAACCACCGGTGCAAGCGGATGGACCGAAAAGACAGACGCAGCCTAGCATGAGCGTGGAGCAGGC
TGCGAAGCCGACTTTCCATATCTATGTCGGAGATCCGCACAAAGTGGGAGATCTGACAAGCAGTCATATTGTGTA
TCAAGTTTCGACAAAGGTAATTAGACACACTAAAATTTACAGTGGAAAAGGAAAGGCTGACAGTACTTTATGGCT
AGACAACTTCTAAGGCCTATCGCCAACCCGAGTTCACCGTTAGCCGTCGATACCGTGATTTCCTCTGGCTCTACA
ACTCCCTGCACAGCAATAACCCGGGAGTGGTCGTTGCGCCTCCGCCCGAGAAGCAAGCAGTTGGCCGGTTTGATA
CCAACTTTGTAGAGTCGAGGAGAGCTGCCTTGGAACGAATGCTCAACAAGATTGCCGGCCATCCTATTCTTCAAC
ATGACGGCGATTTGAAAATTTTCCTAGAAAGTGAAGCTTTCACCGTTGATGTTAAGAATAAGGAAAACAGAGAGC
CTGATATTGGCCCAAGCAAGGGAATGCTGAGCTCCTTTGGTATTTCTGTTGGTGGAGGAACTAAATTCGTGGAAC
ATGACGATGTAAGTGAATCGTTTCTGATACATCGGTCTCGCCTGCTCACCTATAAATAGTGGTTCCACGACCGAA
AAGTTTACCTGGATGCATTGGAGAACCAGCTGAAGGCTCTATTGAAATCAATGGATACTGTGGTTATACAACGAA
AGGGACTATCCGAGGCCGCAAGCGACTTTTCGAGCTCGTTGCATGCCTTATCCGCCGTCGAGCTGTCTCCCGCCC
TTTCCTACCCATTGGAAGGCCTGTCCGAACTTCAGTTGCGCATTCGGGAACTTTATGACCGACAGGCGCAGCAGG
ATGTTCTGACGCTTGGAATCACGATCGATGAATATATCCGTTTAATTGGAAGTGTCAAGTTGGCTTTCACGCAGC
GGCAAAAGGCTTTCCACACCTGGCACGCAGCAGAGTCCGACCTACAGAAGCGCAAGAATAACCAAGACAAGCTAC
TCCGCCAGGGAAAGACTCAGCAAGACCGCTTAAACCAAGTCAACGCCGACGTTGCAGATGCAGAGCGCAAAGTGC
ACCAAACGCGGCTGCTCTTCGAAGATATGGGTCGTCTTATGCGGAACGAACTACAACGGTTTGAGAAGGAGAAAG
TGGAGGACTTCAAGTCTGGCGTGGAAACATTCCTTGAAAGTGCAGTCGAGGCTCAGAAAGAGGTAAGTTCTCGCC
AAGTCTTGGTGGTTTTTTTCATCCAGCTAACCCTAAATACAGTTGATCGAACTCTGGGAGACATTCCTTCTGCGT
CTAGATGCTGGCGAGGAAGGACTTCCGTATTATGTACCCCCCGAGGTGAGCGATGCACCCGCTCCGGCAGAGCCC
ACAGATGAATCGGGGCTACTGGCCGCTGAGGATGACGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail