Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5388.t1
Gene name
Locationscaffold_12:641685..642464
Strand-
Gene length (bp)779
Transcript length (bp)615
Coding sequence length (bp)615
Protein length (aa) 205

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 7.5E-16 56 174

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 89.44 49.43 129.45
5d_25C Five days - 25 degrees Celsius 36.86 16.10 57.62
7d_25C Seven days - 25 degrees Celsius 44.92 20.04 69.79
10d_25C Ten days - 25 degrees Celsius 18.00 5.93 30.08
7d_15C Seven days - 15 degrees Celsius 31.95 12.48 51.42
7d_30C Seven days - 30 degrees Celsius 19.70 7.01 32.40

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.012904 yes
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.604909 no
5d_25C 7d_15C 0.739466 no
5d_25C 7d_30C 0.056880 no
5d_25C 10d_25C 0.028409 yes
7d_25C 7d_15C 0.337148 no
7d_25C 7d_30C 0.009446 yes
7d_25C 10d_25C 0.004450 yes
7d_15C 7d_30C 0.179756 no
7d_15C 10d_25C 0.107450 no
7d_30C 10d_25C 0.866610 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5388.t1
MTQLKSTFLSREPLTSQEAKWKRLVKTNYIDPNGVKRDWESAERQTRPTDSPVDGVNIVAFLNNMNGAEILLEKQ
YRPPIDQVVIELPAGLIDAGETIEQAAVRELKEETGYIGVSDKTTGIMYNDPGFCNANFNMVYVQVDMSLPENQN
PKPDLEDNEFIECFTLPVSELSAELQKLESEGYAIDARVGSIAEGIEIAKRLKL*
Coding >Pro_DTO377G3_2|g5388.t1
ATGACGCAACTTAAGTCCACATTTCTCTCACGAGAGCCCTTGACCTCCCAAGAAGCCAAATGGAAAAGACTAGTC
AAAACGAACTACATCGATCCCAATGGAGTCAAGAGAGACTGGGAGTCTGCCGAACGCCAGACAAGGCCCACAGAC
TCCCCTGTCGATGGAGTCAACATCGTCGCTTTTCTGAATAATATGAACGGCGCTGAGATCCTGCTGGAGAAGCAA
TACCGGCCTCCAATCGACCAGGTCGTTATAGAACTCCCTGCGGGATTGATCGATGCCGGAGAGACAATCGAGCAA
GCTGCAGTTCGAGAGCTGAAAGAAGAGACAGGGTATATCGGCGTTTCTGATAAAACCACTGGCATTATGTATAAC
GATCCCGGCTTCTGCAATGCCAATTTCAACATGGTTTACGTTCAGGTTGACATGTCTCTTCCGGAAAATCAGAAT
CCAAAGCCTGATCTCGAGGATAATGAGTTCATTGAATGTTTCACGCTTCCGGTGTCGGAGCTTTCGGCTGAGTTG
CAAAAGTTGGAGAGTGAAGGGTATGCGATTGATGCACGAGTGGGATCCATTGCCGAGGGGATTGAGATTGCAAAG
AGGTTGAAACTTTGA
Transcript >Pro_DTO377G3_2|g5388.t1
ATGACGCAACTTAAGTCCACATTTCTCTCACGAGAGCCCTTGACCTCCCAAGAAGCCAAATGGAAAAGACTAGTC
AAAACGAACTACATCGATCCCAATGGAGTCAAGAGAGACTGGGAGTCTGCCGAACGCCAGACAAGGCCCACAGAC
TCCCCTGTCGATGGAGTCAACATCGTCGCTTTTCTGAATAATATGAACGGCGCTGAGATCCTGCTGGAGAAGCAA
TACCGGCCTCCAATCGACCAGGTCGTTATAGAACTCCCTGCGGGATTGATCGATGCCGGAGAGACAATCGAGCAA
GCTGCAGTTCGAGAGCTGAAAGAAGAGACAGGGTATATCGGCGTTTCTGATAAAACCACTGGCATTATGTATAAC
GATCCCGGCTTCTGCAATGCCAATTTCAACATGGTTTACGTTCAGGTTGACATGTCTCTTCCGGAAAATCAGAAT
CCAAAGCCTGATCTCGAGGATAATGAGTTCATTGAATGTTTCACGCTTCCGGTGTCGGAGCTTTCGGCTGAGTTG
CAAAAGTTGGAGAGTGAAGGGTATGCGATTGATGCACGAGTGGGATCCATTGCCGAGGGGATTGAGATTGCAAAG
AGGTTGAAACTTTGA
Gene >Pro_DTO377G3_2|g5388.t1
ATGACGCAACTTAAGTCCACATTTCTCTCACGAGAGCCCTTGGTATGTGCTCCTAACCCGACTATTATATTCTCA
GCTACTTACGGCCTTAGACCTCCCAAGAAGCCAAATGGAAAAGACTAGTCAAAACGAACTACATCGATCCCAATG
GAGTCAAGAGAGACTGGGAGTCTGCCGAACGCCAGGTACGATTTTCTAACCTATATGTAAATGCAACTGTAAAGA
CCTAATCAAATCGTAGACAAGGCCCACAGACTCCCCTGTCGATGGAGTCAACATCGTCGCTTTTCTGAATAATAT
GAACGGCGCTGAGATCCTGCTGGAGAAGCAATACCGGCCTCCAATCGACCAGGTCGTTATAGAACTCCCTGCGGG
ATTGATCGATGCCGGAGAGACAATCGAGCAAGCTGCAGTTCGAGAGCTGAAAGAAGAGACAGGGTATATCGGCGT
TTCTGATAAAACCACTGGCATTATGTATAACGGTTGGTAAGCCCGCTGTTCGTCTTACTGGATATTAGCTGACTT
AAGATACTTGTCCAGATCCCGGCTTCTGCAATGCCAATTTCAACATGGTTTACGTTCAGGTTGACATGTCTCTTC
CGGAAAATCAGAATCCAAAGCCTGATCTCGAGGATAATGAGTTCATTGAATGTTTCACGCTTCCGGTGTCGGAGC
TTTCGGCTGAGTTGCAAAAGTTGGAGAGTGAAGGGTATGCGATTGATGCACGAGTGGGATCCATTGCCGAGGGGA
TTGAGATTGCAAAGAGGTTGAAACTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail