Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5382.t1
Gene name
Locationscaffold_12:630777..631737
Strand+
Gene length (bp)960
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 2.7E-09 21 98
PF00153 Mito_carr Mitochondrial carrier protein 6.7E-05 112 198
PF00153 Mito_carr Mitochondrial carrier protein 2.3E-14 216 315

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 67 89 22
2 169 191 22
3 215 237 22
4 282 304 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1.39 0.01 2.78
5d_25C Five days - 25 degrees Celsius 1.09 0.00 2.26
7d_25C Seven days - 25 degrees Celsius 1.26 0.00 2.59
10d_25C Ten days - 25 degrees Celsius 0.43 0.00 1.03
7d_15C Seven days - 15 degrees Celsius 0.85 0.00 2.10
7d_30C Seven days - 30 degrees Celsius 0.74 0.00 1.60

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.767692 no
3d_25C 7d_25C 0.908375 no
3d_25C 7d_15C 0.568464 no
3d_25C 7d_30C 0.371326 no
3d_25C 10d_25C 0.129711 no
5d_25C 7d_25C 0.877319 no
5d_25C 7d_15C 0.814867 no
5d_25C 7d_30C 0.649600 no
5d_25C 10d_25C 0.257900 no
7d_25C 7d_15C 0.679724 no
7d_25C 7d_30C 0.485456 no
7d_25C 10d_25C 0.176097 no
7d_15C 7d_30C 0.905637 no
7d_15C 10d_25C 0.523559 no
7d_30C 10d_25C 0.567462 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5382.t1
MSTFNGLEITTASRPIPPYQASIVAALASEGAIHPIDTVITRMQSPMYSSVYKHLNGTLSRALFSGLYQGFGPTF
FAGTLSSAAFFTAYEASKTAFSNAQAAGYMLGVPRPLIHVASSAVAELLACAIQNPAEVLKQNAQVFQRPVNADR
GPSPTMEMLRRFRKYPAGLWAGYSTLVASQLPGMCVTFCLYEMFKEDLLERWKTGKDDIRQQLEATVLGAGAAGG
CASWLFVPINVVKTRMRLAVGDQIDSTRSGLKGNPGLPSRIGAFAIARDVLRKEGVAGLFRGSALTCVAAIVGSG
LYIGCYEGTKIYLCNYEGS*
Coding >Pro_DTO377G3_2|g5382.t1
ATGTCCACATTCAATGGCTTAGAAATAACAACAGCAAGTCGACCCATCCCACCCTACCAGGCCTCAATAGTCGCC
GCACTAGCGAGCGAAGGAGCCATCCACCCAATAGACACAGTAATAACACGCATGCAATCCCCGATGTACAGCAGC
GTCTACAAGCACCTAAACGGCACACTGAGCCGCGCACTCTTCAGCGGGCTATACCAAGGCTTCGGGCCAACCTTC
TTCGCAGGAACACTCTCATCAGCTGCTTTCTTCACCGCATACGAAGCCTCAAAGACGGCATTTAGCAATGCACAG
GCCGCCGGATATATGCTCGGCGTCCCGCGGCCGCTGATCCACGTTGCTAGTAGTGCTGTTGCCGAACTGCTTGCA
TGCGCTATCCAGAACCCGGCTGAGGTGTTGAAGCAGAATGCTCAGGTTTTTCAGCGGCCAGTCAATGCAGACAGG
GGCCCGTCTCCGACGATGGAGATGTTGCGAAGGTTTCGGAAATATCCGGCTGGGTTGTGGGCCGGGTATAGTACG
TTAGTGGCGAGTCAATTGCCGGGGATGTGTGTTACGTTCTGTTTGTATGAGATGTTCAAGGAGGATTTGCTTGAG
CGGTGGAAGACGGGGAAAGATGATATTAGACAGCAGCTTGAAGCGACTGTTTTGGGTGCTGGTGCTGCTGGAGGT
TGCGCGTCTTGGTTGTTTGTTCCTATCAATGTGGTTAAGACGAGGATGAGGCTTGCGGTTGGTGATCAGATAGAT
AGCACTCGGTCAGGTCTCAAGGGAAACCCTGGCTTGCCATCCCGTATCGGGGCATTTGCTATTGCTCGAGATGTG
CTGCGGAAGGAGGGTGTAGCTGGGTTATTTCGGGGGTCTGCTTTGACCTGCGTGGCAGCGATTGTGGGGAGTGGA
CTTTATATTGGGTGTTATGAGGGGACGAAGATATACTTGTGCAATTATGAAGGCTCATAG
Transcript >Pro_DTO377G3_2|g5382.t1
ATGTCCACATTCAATGGCTTAGAAATAACAACAGCAAGTCGACCCATCCCACCCTACCAGGCCTCAATAGTCGCC
GCACTAGCGAGCGAAGGAGCCATCCACCCAATAGACACAGTAATAACACGCATGCAATCCCCGATGTACAGCAGC
GTCTACAAGCACCTAAACGGCACACTGAGCCGCGCACTCTTCAGCGGGCTATACCAAGGCTTCGGGCCAACCTTC
TTCGCAGGAACACTCTCATCAGCTGCTTTCTTCACCGCATACGAAGCCTCAAAGACGGCATTTAGCAATGCACAG
GCCGCCGGATATATGCTCGGCGTCCCGCGGCCGCTGATCCACGTTGCTAGTAGTGCTGTTGCCGAACTGCTTGCA
TGCGCTATCCAGAACCCGGCTGAGGTGTTGAAGCAGAATGCTCAGGTTTTTCAGCGGCCAGTCAATGCAGACAGG
GGCCCGTCTCCGACGATGGAGATGTTGCGAAGGTTTCGGAAATATCCGGCTGGGTTGTGGGCCGGGTATAGTACG
TTAGTGGCGAGTCAATTGCCGGGGATGTGTGTTACGTTCTGTTTGTATGAGATGTTCAAGGAGGATTTGCTTGAG
CGGTGGAAGACGGGGAAAGATGATATTAGACAGCAGCTTGAAGCGACTGTTTTGGGTGCTGGTGCTGCTGGAGGT
TGCGCGTCTTGGTTGTTTGTTCCTATCAATGTGGTTAAGACGAGGATGAGGCTTGCGGTTGGTGATCAGATAGAT
AGCACTCGGTCAGGTCTCAAGGGAAACCCTGGCTTGCCATCCCGTATCGGGGCATTTGCTATTGCTCGAGATGTG
CTGCGGAAGGAGGGTGTAGCTGGGTTATTTCGGGGGTCTGCTTTGACCTGCGTGGCAGCGATTGTGGGGAGTGGA
CTTTATATTGGGTGTTATGAGGGGACGAAGATATACTTGTGCAATTATGAAGGCTCATAG
Gene >Pro_DTO377G3_2|g5382.t1
ATGTCCACATTCAATGGCTTAGAAATAACAACAGCAAGTCGACCCATCCCACCCTACCAGGCCTCAATAGTCGCC
GCACTAGCGAGCGAAGGAGCCATCCACCCAATAGACACAGTAATAACACGCATGCAATCCCCGATGTACAGCAGC
GTCTACAAGCACCTAAACGGCACACTGAGCCGCGCACTCTTCAGCGGGCTATACCAAGGCTTCGGGCCAACCTTC
TTCGCAGGAACACTCTCATCAGCTGCTTTCTTCACCGCATACGAAGCCTCAAAGACGGCATTTAGCAATGCACAG
GCCGCCGGATATATGCTCGGCGTCCCGCGGCCGCTGATCCACGTTGCTAGTAGTGCTGTTGCCGAACTGCTTGCA
TGCGCTATCCAGAACCCGGCTGAGGTGTTGAAGCAGAATGCTCAGGTTTTTCAGCGGCCAGTCAATGCAGACAGG
GGCCCGTCTCCGACGATGGAGATGTTGCGAAGGTTTCGGAAATATCCGGCTGGGTTGTGGGCCGGGTATAGTACG
TTAGTGGCGAGTCAATTGCCGGGGATGTGTGTTACGTTCTGTTTGTATGAGATGTTCAAGGAGGATTTGCTTGAG
CGGTGGAAGACGGGGAAAGATGATATTAGACAGCAGCTTGAAGCGACTGTTTTGGGTGCTGGTGCTGCTGGAGGT
TGCGCGTCTTGGTTGTTTGTTCCTATCAATGTGGTTAAGACGAGGATGAGGCTTGCGGTTGGTGATCAGATAGAT
AGCACTCGGTCAGGTCTCAAGGGAAACCCTGGCTTGCCATCCCGTATCGGGGCATTTGCTATTGCTCGAGATGTG
CTGCGGAAGGAGGGTGTAGCTGGGTTATTTCGGGGGTCTGCTTTGACCTGCGTGGCAGCGATTGTGGGGAGTGGA
CTTTATATTGGGTGTTATGAGGGGACGAAGATATACTTGTGCAATTATGAAGGCTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail