Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5356.t1
Gene name
Locationscaffold_12:561436..563445
Strand-
Gene length (bp)2009
Transcript length (bp)1887
Coding sequence length (bp)1887
Protein length (aa) 629

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07662 Nucleos_tra2_C Na+ dependent nucleoside transporter C-terminus 7.8E-74 400 614
PF01773 Nucleos_tra2_N Na+ dependent nucleoside transporter N-terminus 5.7E-23 208 278

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

Domain # Start End Length
1 96 118 22
2 123 145 22
3 205 222 17
4 227 249 22
5 256 278 22
6 293 315 22
7 328 350 22
8 374 396 22
9 462 484 22
10 494 513 19
11 556 578 22
12 593 615 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5356.t1
MEKTHEVDPAGSQVVHHVDPVLDPEHQHHHAHHHHTAFAEQGRQDEVVYSKDVEFEKGIVPEQTPLDHGRKNSDD
EEAGETLPVKRTWYRRVGKQWRHIFHAVVWLLFTGWWIAGLILHRHDIGWLIPFLLYLAITLRIIFFYVPITVVS
RPMHWVWGRTAHPFVRLIPEKIRTPSAAALCIAVILVGSFVSEESQDNTRANRAVSLFGMVVFIFGLWLTSRNRK
KIVWHTVIVGMLAQFIIALFVLRTTAGYDIFNFISSLATDLLGFAADGVIFLTSEDFYYFDKGFAPQQFFIVSVI
SAIIFFVAFVQLLYYFNILQWFIGKFAVFFFWSMRVSGAEAVVAAASPFIGQGESAMLIRPFIAHLTMAELHQIM
CSGFATIAGSVLIAYISIGVNPQAMVSACVMSIPASLAVSKLRWPEEEETLTAGRVVVPDDDEHRSANALHAFTS
GTWLGLKIAAMIASTLLCIIALIGLVNGLLTWWGRYLNINDPPLTLELIVGYICYPIAFLLGVSRDGDLLKVAQL
IGTKLVTNEFVAYDALQNNADYKDLSDRSRLIVTYALCGFANIGSLGNQIGVLSQIAPGRGKDVSRVAFSAMVTG
AISTFTSATIAGLLITNEKQYFGTSTTS*
Coding >Pro_DTO377G3_2|g5356.t1
ATGGAGAAAACCCATGAAGTTGATCCAGCAGGATCGCAGGTTGTTCACCATGTAGATCCTGTGCTGGATCCAGAG
CATCAGCATCACCATGCTCATCACCACCATACCGCCTTCGCCGAACAGGGACGTCAGGATGAAGTGGTCTACTCG
AAAGATGTCGAGTTTGAAAAAGGAATCGTGCCTGAACAAACACCTCTGGACCACGGCAGGAAGAACTCCGACGAT
GAGGAAGCCGGCGAGACTCTCCCAGTTAAGCGCACTTGGTATCGTCGTGTGGGAAAACAATGGAGACATATATTC
CATGCCGTGGTCTGGCTACTGTTTACCGGTTGGTGGATTGCCGGCCTGATCCTACACCGACATGATATAGGATGG
CTCATCCCATTCCTGCTCTATCTTGCCATCACGCTGCGAATAATCTTCTTCTATGTCCCCATTACTGTCGTGTCA
AGGCCCATGCACTGGGTCTGGGGGCGTACCGCTCACCCTTTCGTGCGCCTCATTCCCGAGAAGATCAGAACACCC
AGTGCCGCCGCGCTATGCATCGCTGTGATTCTTGTTGGCTCGTTCGTTTCCGAAGAATCACAGGATAACACCCGT
GCCAACCGTGCAGTCAGTCTGTTCGGTATGGTGGTCTTCATCTTCGGGCTATGGCTCACATCTCGAAACCGCAAG
AAGATCGTCTGGCACACTGTCATTGTCGGTATGCTGGCGCAATTCATCATTGCTCTGTTCGTGCTCCGCACCACT
GCAGGATACGACATCTTCAACTTCATCTCAAGCCTAGCCACTGATCTGCTCGGTTTCGCCGCCGACGGAGTCATA
TTCCTAACCAGCGAGGATTTCTACTACTTTGACAAGGGCTTTGCCCCACAGCAATTCTTCATTGTCAGCGTCATC
TCCGCCATCATCTTCTTCGTCGCCTTCGTCCAGCTCTTGTACTACTTCAATATCCTGCAGTGGTTCATTGGCAAG
TTCGCCGTCTTCTTCTTCTGGAGCATGCGCGTTTCCGGCGCCGAAGCCGTTGTCGCCGCCGCATCCCCCTTCATC
GGCCAGGGTGAATCCGCCATGCTGATCCGTCCCTTCATCGCCCATCTTACCATGGCCGAGCTGCACCAAATCATG
TGCTCTGGCTTCGCCACCATCGCCGGAAGTGTCCTGATCGCCTATATCAGCATCGGTGTCAACCCACAGGCAATG
GTCAGCGCGTGTGTGATGAGTATCCCCGCTTCACTGGCAGTCTCAAAACTACGTTGGCCCGAAGAGGAAGAAACC
CTTACTGCAGGCCGTGTCGTGGTCCCCGATGACGACGAACACCGCTCTGCCAACGCCCTCCACGCATTCACCAGC
GGCACCTGGCTCGGTCTGAAGATCGCCGCCATGATCGCATCAACCCTCCTGTGCATCATCGCTCTCATTGGTCTA
GTCAACGGCCTCCTCACTTGGTGGGGCCGATACCTGAACATCAACGACCCCCCACTGACCCTCGAGTTGATCGTC
GGATACATCTGCTACCCGATTGCCTTCCTCCTCGGTGTCTCCCGGGACGGGGATCTACTCAAGGTTGCCCAACTG
ATTGGTACCAAGCTCGTTACCAACGAATTCGTCGCCTACGACGCTCTCCAAAATAACGCAGACTACAAGGATCTC
TCCGACCGCTCTCGCCTTATCGTTACATACGCACTGTGTGGATTCGCGAATATCGGCTCCCTCGGTAACCAGATC
GGTGTCCTGTCGCAGATTGCACCTGGTCGCGGTAAGGATGTGTCCCGTGTTGCATTTAGTGCTATGGTTACCGGA
GCCATTAGCACTTTCACTAGTGCCACGATTGCCGGCTTGTTGATTACCAATGAGAAGCAGTACTTCGGTACCTCC
ACGACATCTTAA
Transcript >Pro_DTO377G3_2|g5356.t1
ATGGAGAAAACCCATGAAGTTGATCCAGCAGGATCGCAGGTTGTTCACCATGTAGATCCTGTGCTGGATCCAGAG
CATCAGCATCACCATGCTCATCACCACCATACCGCCTTCGCCGAACAGGGACGTCAGGATGAAGTGGTCTACTCG
AAAGATGTCGAGTTTGAAAAAGGAATCGTGCCTGAACAAACACCTCTGGACCACGGCAGGAAGAACTCCGACGAT
GAGGAAGCCGGCGAGACTCTCCCAGTTAAGCGCACTTGGTATCGTCGTGTGGGAAAACAATGGAGACATATATTC
CATGCCGTGGTCTGGCTACTGTTTACCGGTTGGTGGATTGCCGGCCTGATCCTACACCGACATGATATAGGATGG
CTCATCCCATTCCTGCTCTATCTTGCCATCACGCTGCGAATAATCTTCTTCTATGTCCCCATTACTGTCGTGTCA
AGGCCCATGCACTGGGTCTGGGGGCGTACCGCTCACCCTTTCGTGCGCCTCATTCCCGAGAAGATCAGAACACCC
AGTGCCGCCGCGCTATGCATCGCTGTGATTCTTGTTGGCTCGTTCGTTTCCGAAGAATCACAGGATAACACCCGT
GCCAACCGTGCAGTCAGTCTGTTCGGTATGGTGGTCTTCATCTTCGGGCTATGGCTCACATCTCGAAACCGCAAG
AAGATCGTCTGGCACACTGTCATTGTCGGTATGCTGGCGCAATTCATCATTGCTCTGTTCGTGCTCCGCACCACT
GCAGGATACGACATCTTCAACTTCATCTCAAGCCTAGCCACTGATCTGCTCGGTTTCGCCGCCGACGGAGTCATA
TTCCTAACCAGCGAGGATTTCTACTACTTTGACAAGGGCTTTGCCCCACAGCAATTCTTCATTGTCAGCGTCATC
TCCGCCATCATCTTCTTCGTCGCCTTCGTCCAGCTCTTGTACTACTTCAATATCCTGCAGTGGTTCATTGGCAAG
TTCGCCGTCTTCTTCTTCTGGAGCATGCGCGTTTCCGGCGCCGAAGCCGTTGTCGCCGCCGCATCCCCCTTCATC
GGCCAGGGTGAATCCGCCATGCTGATCCGTCCCTTCATCGCCCATCTTACCATGGCCGAGCTGCACCAAATCATG
TGCTCTGGCTTCGCCACCATCGCCGGAAGTGTCCTGATCGCCTATATCAGCATCGGTGTCAACCCACAGGCAATG
GTCAGCGCGTGTGTGATGAGTATCCCCGCTTCACTGGCAGTCTCAAAACTACGTTGGCCCGAAGAGGAAGAAACC
CTTACTGCAGGCCGTGTCGTGGTCCCCGATGACGACGAACACCGCTCTGCCAACGCCCTCCACGCATTCACCAGC
GGCACCTGGCTCGGTCTGAAGATCGCCGCCATGATCGCATCAACCCTCCTGTGCATCATCGCTCTCATTGGTCTA
GTCAACGGCCTCCTCACTTGGTGGGGCCGATACCTGAACATCAACGACCCCCCACTGACCCTCGAGTTGATCGTC
GGATACATCTGCTACCCGATTGCCTTCCTCCTCGGTGTCTCCCGGGACGGGGATCTACTCAAGGTTGCCCAACTG
ATTGGTACCAAGCTCGTTACCAACGAATTCGTCGCCTACGACGCTCTCCAAAATAACGCAGACTACAAGGATCTC
TCCGACCGCTCTCGCCTTATCGTTACATACGCACTGTGTGGATTCGCGAATATCGGCTCCCTCGGTAACCAGATC
GGTGTCCTGTCGCAGATTGCACCTGGTCGCGGTAAGGATGTGTCCCGTGTTGCATTTAGTGCTATGGTTACCGGA
GCCATTAGCACTTTCACTAGTGCCACGATTGCCGGCTTGTTGATTACCAATGAGAAGCAGTACTTCGGTACCTCC
ACGACATCTTAA
Gene >Pro_DTO377G3_2|g5356.t1
ATGGAGAAAACCCATGAAGTTGATCCAGCAGGATCGCAGGTTGTTCACCATGTAGATCCTGTGCTGGATCCAGAG
CATCAGCATCACCATGCTCATCACCACCATACCGCCTTCGCCGAACAGGGACGTCAGGATGAAGTGGTCTACTCG
AAAGATGTCGAGTTTGAAAAAGGAATCGTGCCTGAACAAACACCTCTGGACCACGGCAGGAAGAACTCCGACGAT
GAGGAAGCCGGCGAGACTCTCCCAGTTAAGCGCACTTGGTATCGTCGTGTGGGAAAACAATGGAGACATATATTC
CATGCCGTGGTCTGGCTACTGTTTACCGGGTAGGTGAAGACTTCGATCCTACTACTGTATCCTGGACTCAACACG
AGGCTCACACATACTCTTCACATAGTTGGTGGATTGCCGGCCTGATCCTACACCGACATGATATAGGATGGCTCA
TCCCATTCCTGCTCTATCTTGCCATCACGCTGCGAATAATCTTCTTCTATGTCCCCATTACTGTCGTGTCAAGGC
CCATGCACTGGGTCTGGGGGCGTACCGCTCACCCTTTCGTGCGCCTCATTCCCGAGAAGATCAGAACACCCAGTG
CCGCCGCGCTATGCATCGCTGTGATTCTTGTTGGCTCGTTCGTTTCCGAAGAATCACAGGATAACACCCGTGCCA
ACCGTGCAGTCAGTCTGTTCGGTATGGTGGTCTTCATCTTCGGGCTATGGCTCACATCTCGAAACCGCAAGAAGA
TCGTCTGGCACACTGTCATTGTCGGTATGCTGGCGCAATTCATCATTGCTCTGTTCGTGCTCCGCACCACTGCAG
GATACGACATCTTCAACTTCATCTCAAGCCTAGCCACTGATCTGCTCGGTTTCGCCGCCGACGGAGTCATATTCC
TAACCAGCGAGGATTTCTACTACTTTGACAAGGGCTTTGCCCCACAGCAATTCTTCATTGTCAGCGTCATCTCCG
CCATCATCTTCTTCGTCGCCTTCGTCCAGCTCTTGTACTACTTCAATATCCTGCAGTGGTTCATTGGCAAGTTCG
CCGTCTTCTTCTTCTGGAGCATGCGCGTTTCCGGCGCCGAAGCCGTTGTCGCCGCCGCATCCCCCTTCATCGGCC
AGGGTGAATCCGCCATGCTGATCCGTCCCTTCATCGCCCATCTTACCATGGCCGAGCTGCACCAAATCATGTGCT
CTGGCTTCGCCACCATCGCCGGAAGTGTCCTGATCGCCTATATCAGCATCGGTGTCAACCCACAGGCAATGGTCA
GCGCGTGTGTGATGAGTATCCCCGCTTCACTGGCAGTCTCAAAACTACGTTGGCCCGAAGAGGAAGAAACCCTTA
CTGCAGGCCGTGTCGTGGTCCCCGATGACGACGAACACCGCTCTGCCAACGCCCTCCACGCATTCACCAGCGGCA
CCTGGCTCGGTCTGAAGATCGCCGCCATGATCGCATCAACCCTCCTGTGCATCATCGCTCTCATTGGTCTAGTCA
ACGGCCTCCTCACTTGGTGGGGCCGATACCTGAACATCAACGACCCCCCACTGACCCTCGAGTTGATCGTCGGAT
ACATCTGCTACCCGATTGCCTTCCTCCTCGGTGTCTCCCGGGACGGGGATCTACTCAAGGTTGCCCAACTGATTG
GTACCAAGCTCGTTACCGTAAGTTTCCCTTCTTAATAAACAATAATTCCCTCTTCTAATCAGCCACAGAACGAAT
TCGTCGCCTACGACGCTCTCCAAAATAACGCAGACTACAAGGATCTCTCCGACCGCTCTCGCCTTATCGTTACAT
ACGCACTGTGTGGATTCGCGAATATCGGCTCCCTCGGTAACCAGATCGGTGTCCTGTCGCAGATTGCACCTGGTC
GCGGTAAGGATGTGTCCCGTGTTGCATTTAGTGCTATGGTTACCGGAGCCATTAGCACTTTCACTAGTGCCACGA
TTGCCGGCTTGTTGATTACCAATGAGAAGCAGTACTTCGGTACCTCCACGACATCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail