Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5345.t1
Gene name
Locationscaffold_12:534644..536148
Strand-
Gene length (bp)1504
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06772 LtrA Bacterial low temperature requirement A protein (LtrA) 7.1E-27 41 290

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.5

Transmembrane Domains

Domain # Start End Length
1 105 124 19
2 139 158 19
3 165 187 22
4 191 213 22
5 234 256 22
6 266 288 22
7 301 320 19
8 358 377 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5345.t1
MSASTPEEPQSNPRFLFHQPRALQWFEDGKLMRRQDGERQAGRFELFLDLLYVAILSNFADTLAEDISGAKLVKY
ILILAPSWNVWSDLRELMNAFYTDDLLQRILILWVMAVLVVYGNNAPLVDEEIGAMRSAVGSYMVARISCNLAHV
FYSFASYHHRPQQRLWVVLSSLSLCIYIPLYFESVSIRGKIAAAAVAISVETMVWILCYSPAGKKLLRVRWSTAV
DIAHEIDRFSAFYIIALGEFLYLIIVGSYAAVGLNKRLLRAVWTLVIAFCLNWLLLAGGHVAAQSVAEKEFEAPQ
RWLLCGGLGAGMIFLYVFALLHKSNDESGTLILDKPFRLIMRPAVGIITILLPLADHLNATDVLSIIMALFVFTL
IWETITSLKKGACFWETWTDTDYPEDKPEVHNAKNEGTV*
Coding >Pro_DTO377G3_2|g5345.t1
ATGTCGGCCTCAACGCCTGAGGAGCCCCAGTCAAATCCTCGTTTCTTATTCCACCAACCACGCGCCCTACAATGG
TTCGAGGATGGGAAGTTGATGCGCCGTCAGGATGGTGAGCGACAAGCCGGGCGATTCGAGCTATTCCTCGATCTG
CTCTATGTCGCGATCCTGTCGAACTTCGCCGATACCCTCGCTGAAGACATCTCAGGTGCCAAACTGGTCAAATAT
ATTCTGATCCTGGCGCCATCATGGAACGTTTGGAGCGATCTGCGCGAGTTGATGAACGCCTTCTACACCGACGAT
CTCCTACAGCGCATCCTGATTCTGTGGGTCATGGCCGTACTGGTCGTATACGGCAACAACGCCCCACTCGTCGAC
GAGGAGATCGGTGCCATGCGCTCCGCCGTGGGATCCTACATGGTCGCGCGAATCTCATGCAACCTCGCCCACGTA
TTCTACTCCTTCGCCAGCTACCACCACCGTCCGCAGCAGCGCCTCTGGGTTGTCCTTTCCAGTCTGTCACTATGC
ATTTACATCCCACTATACTTCGAGTCAGTCTCGATCCGCGGCAAGATCGCGGCTGCTGCTGTCGCTATCTCGGTT
GAGACCATGGTTTGGATTCTGTGCTACTCGCCGGCTGGTAAGAAACTCCTTCGCGTCAGGTGGTCGACGGCAGTG
GATATCGCTCACGAAATTGATCGGTTCTCTGCATTCTACATCATTGCGCTGGGCGAGTTTCTCTATTTGATTATT
GTTGGCTCCTATGCTGCAGTTGGACTCAATAAACGCCTTCTGCGAGCTGTTTGGACATTGGTTATTGCGTTCTGT
TTGAATTGGCTTCTGCTAGCTGGCGGACATGTTGCGGCACAGTCAGTTGCCGAGAAAGAGTTCGAAGCTCCACAG
CGCTGGCTCCTTTGTGGCGGTCTGGGTGCAGGCATGATCTTTTTGTACGTGTTTGCTCTGCTGCACAAGTCCAAT
GATGAATCGGGGACTTTGATCTTGGACAAGCCTTTCCGACTCATCATGCGCCCTGCAGTCGGTATCATCACGATC
CTTTTGCCCCTGGCTGACCACCTGAATGCAACTGACGTGTTGTCAATCATCATGGCCTTGTTTGTGTTTACTCTA
ATTTGGGAGACTATCACTTCGCTCAAGAAGGGTGCCTGTTTCTGGGAGACCTGGACAGACACGGACTACCCCGAG
GACAAACCCGAAGTTCATAATGCCAAGAACGAAGGGACAGTTTGA
Transcript >Pro_DTO377G3_2|g5345.t1
ATGTCGGCCTCAACGCCTGAGGAGCCCCAGTCAAATCCTCGTTTCTTATTCCACCAACCACGCGCCCTACAATGG
TTCGAGGATGGGAAGTTGATGCGCCGTCAGGATGGTGAGCGACAAGCCGGGCGATTCGAGCTATTCCTCGATCTG
CTCTATGTCGCGATCCTGTCGAACTTCGCCGATACCCTCGCTGAAGACATCTCAGGTGCCAAACTGGTCAAATAT
ATTCTGATCCTGGCGCCATCATGGAACGTTTGGAGCGATCTGCGCGAGTTGATGAACGCCTTCTACACCGACGAT
CTCCTACAGCGCATCCTGATTCTGTGGGTCATGGCCGTACTGGTCGTATACGGCAACAACGCCCCACTCGTCGAC
GAGGAGATCGGTGCCATGCGCTCCGCCGTGGGATCCTACATGGTCGCGCGAATCTCATGCAACCTCGCCCACGTA
TTCTACTCCTTCGCCAGCTACCACCACCGTCCGCAGCAGCGCCTCTGGGTTGTCCTTTCCAGTCTGTCACTATGC
ATTTACATCCCACTATACTTCGAGTCAGTCTCGATCCGCGGCAAGATCGCGGCTGCTGCTGTCGCTATCTCGGTT
GAGACCATGGTTTGGATTCTGTGCTACTCGCCGGCTGGTAAGAAACTCCTTCGCGTCAGGTGGTCGACGGCAGTG
GATATCGCTCACGAAATTGATCGGTTCTCTGCATTCTACATCATTGCGCTGGGCGAGTTTCTCTATTTGATTATT
GTTGGCTCCTATGCTGCAGTTGGACTCAATAAACGCCTTCTGCGAGCTGTTTGGACATTGGTTATTGCGTTCTGT
TTGAATTGGCTTCTGCTAGCTGGCGGACATGTTGCGGCACAGTCAGTTGCCGAGAAAGAGTTCGAAGCTCCACAG
CGCTGGCTCCTTTGTGGCGGTCTGGGTGCAGGCATGATCTTTTTGTACGTGTTTGCTCTGCTGCACAAGTCCAAT
GATGAATCGGGGACTTTGATCTTGGACAAGCCTTTCCGACTCATCATGCGCCCTGCAGTCGGTATCATCACGATC
CTTTTGCCCCTGGCTGACCACCTGAATGCAACTGACGTGTTGTCAATCATCATGGCCTTGTTTGTGTTTACTCTA
ATTTGGGAGACTATCACTTCGCTCAAGAAGGGTGCCTGTTTCTGGGAGACCTGGACAGACACGGACTACCCCGAG
GACAAACCCGAAGTTCATAATGCCAAGAACGAAGGGACAGTTTGA
Gene >Pro_DTO377G3_2|g5345.t1
ATGTCGGCCTCAACGCCTGAGGAGCCCCAGTCAAATCCTCGTTTCTTATTCCACCAACCACGCGCCCTACAATGG
TTCGAGGATGGGAAGTTGATGCGCCGTCAGGATGGTGAGCGACAAGCCGGGCGATTCGAGCTATTCCTCGATCTG
CTCTATGTCGCGATCCTGTCGAACTTCGCCGATACCCTCGCTGAAGACATCTCAGGTGCCAAACTGGTCAAATAT
ATTGTGAGTTGGCCGCCCTTCTACTATCGGGTCCACCATCGCCTCCACTATCCCATCCACTTTCAGACGCGATAG
ATAAGCTAACACGCTCACAGCTGATCCTGGCGCCATCATGGAACGTTTGGAGCGATCTGCGCGAGTTGATGAACG
CCTTCTACACCGACGATCTCCTACAGCGCATCCTGATTCTGTGGGTCATGGCCGTACTGGTCGTATACGGCAACA
ACGCCCCACTCGTCGACGAGGAGATCGGTGCCATGCGCTCCGCCGTGGGATCCTACATGGTCGCGCGAATCTCAT
GCAACCTCGCCCACGTATTCTACTCCTTCGCCAGCTACCACCACCGTCCGCAGCAGCGCCTCTGGGTTGTCCTTT
CCAGTCTGTCACTATGCATTTACATCCCACTATACTTCGAGTCAGTCTCGATCCGCGGCAAGATCGCGGCTGCTG
CTGTCGCTATCTCGGTTGAGACCATGGTTTGGATTCTGTGCTACTCGCCGGCTGGTAAGAAACTCCTTCGCGTCA
GGTGGTCGACGGCAGTGGATATCGCTCACGAAATTGATCGGTTCTCTGCATTCTACATCATTGCGCTGGGCGAGT
TTCTCTATTTGATTATTGTTGGCTCCTATGCTGCAGTTGGACTCAATAAACGCCTTCTGCGAGCTGTTTGGACAT
TGGTTATTGCGTTCTGTTTGAATTGGCTGTATGCCCACGCCGATGGCTCATTAAATACCACTCACCCCTGCGGCA
CTCGGTTTATACAGCTTTTTCCTGGGCCCTGATTCATCTACCACTTATTGCCAGTCTGCTAGCTGGCGGACATGT
TGCGGCACAGTCAGTTGCCGAGAAAGAGTTCGAAGCTCCACAGCGCTGGCTCCTTTGTGGCGGTCTGGGTGCAGG
CATGATCTTTTTGTACGTGTTTGCTCTGCTGCACAAGTCCAATGATGAATCGGGGACTTTGATCTTGGACAAGGT
AAGTCAACGCCCCCTCCGTCTATTACTTGCATCCCACCACGCCAGTCACTAATGTTTGTCCTAGCCTTTCCGACT
CATCATGCGCCCTGCAGTCGGTATCATCACGATCCTTTTGCCCCTGGCTGACCACCTGAATGCAACTGACGTGTT
GTCAATCATCATGGCCTTGTTTGTGTTTACTCTAATTTGGGAGACTATCACTTCGCTCAAGAAGGGTGCCTGTTT
CTGGGAGACCTGGACAGACACGGACTACCCCGAGGACAAACCCGAAGTTCATAATGCCAAGAACGAAGGGACAGT
TTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail