Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5320.t1
Gene name
Locationscaffold_12:473842..474442
Strand-
Gene length (bp)600
Transcript length (bp)537
Coding sequence length (bp)537
Protein length (aa) 179

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12973 Cupin_7 ChrR Cupin-like domain 1.1E-13 42 130

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 7.09 1.32 12.87
5d_25C Five days - 25 degrees Celsius 6.80 1.20 12.41
7d_25C Seven days - 25 degrees Celsius 4.77 0.56 8.97
10d_25C Ten days - 25 degrees Celsius 6.73 0.78 12.67
7d_15C Seven days - 15 degrees Celsius 10.67 2.23 19.11
7d_30C Seven days - 30 degrees Celsius 9.93 2.37 17.50

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.953106 no
3d_25C 7d_25C 0.469055 no
3d_25C 7d_15C 0.420182 no
3d_25C 7d_30C 0.497305 no
3d_25C 10d_25C 0.940967 no
5d_25C 7d_25C 0.522906 no
5d_25C 7d_15C 0.360080 no
5d_25C 7d_30C 0.433391 no
5d_25C 10d_25C 0.987971 no
7d_25C 7d_15C 0.090912 no
7d_25C 7d_30C 0.113395 no
7d_25C 10d_25C 0.563523 no
7d_15C 7d_30C 0.913764 no
7d_15C 10d_25C 0.366608 no
7d_30C 10d_25C 0.439385 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5320.t1
MSKTMEKGDLSTAAYRGPKLPSVPDDLVVTGVLDLECDERFWVPQAKDVWFRPLCFNVSHGYFVNILRVRKSGIL
SRHRHTGPVHATVLRGRWHYLEHPWWAEEGGYAFEPPGDIHTLEVPDGVQEMITLFHVTGAYIYVDVDGKALGIE
DVFSKLQAARKHYEEVGLGASFADQFVR*
Coding >Pro_DTO377G3_2|g5320.t1
ATGTCCAAGACAATGGAGAAGGGCGATCTTTCCACCGCAGCTTATCGGGGTCCCAAGCTGCCTAGTGTCCCTGAC
GACTTAGTAGTCACCGGCGTTCTCGACTTGGAATGTGACGAGCGGTTTTGGGTCCCCCAGGCCAAGGATGTTTGG
TTTCGTCCGTTATGCTTCAATGTGTCCCACGGATACTTTGTGAACATCCTACGCGTCAGGAAGAGCGGAATCTTG
TCACGCCACCGACACACAGGACCCGTCCATGCTACTGTTCTACGGGGTCGATGGCACTATCTTGAGCACCCTTGG
TGGGCCGAGGAAGGTGGATATGCCTTCGAGCCCCCCGGCGACATCCACACTTTGGAAGTGCCCGATGGGGTTCAG
GAGATGATTACCTTGTTCCACGTGACGGGCGCGTATATCTACGTGGATGTTGACGGCAAGGCATTGGGAATTGAG
GATGTCTTCAGCAAGCTTCAGGCAGCGCGGAAGCACTACGAGGAGGTTGGTCTGGGCGCCAGCTTTGCGGATCAG
TTTGTGCGGTAG
Transcript >Pro_DTO377G3_2|g5320.t1
ATGTCCAAGACAATGGAGAAGGGCGATCTTTCCACCGCAGCTTATCGGGGTCCCAAGCTGCCTAGTGTCCCTGAC
GACTTAGTAGTCACCGGCGTTCTCGACTTGGAATGTGACGAGCGGTTTTGGGTCCCCCAGGCCAAGGATGTTTGG
TTTCGTCCGTTATGCTTCAATGTGTCCCACGGATACTTTGTGAACATCCTACGCGTCAGGAAGAGCGGAATCTTG
TCACGCCACCGACACACAGGACCCGTCCATGCTACTGTTCTACGGGGTCGATGGCACTATCTTGAGCACCCTTGG
TGGGCCGAGGAAGGTGGATATGCCTTCGAGCCCCCCGGCGACATCCACACTTTGGAAGTGCCCGATGGGGTTCAG
GAGATGATTACCTTGTTCCACGTGACGGGCGCGTATATCTACGTGGATGTTGACGGCAAGGCATTGGGAATTGAG
GATGTCTTCAGCAAGCTTCAGGCAGCGCGGAAGCACTACGAGGAGGTTGGTCTGGGCGCCAGCTTTGCGGATCAG
TTTGTGCGGTAG
Gene >Pro_DTO377G3_2|g5320.t1
ATGTCCAAGGTAAACAGTCGATTACATAAAACGCCTGTGACACTAGCTAACTAACTAATGCCGGTTGTTCAGACA
ATGGAGAAGGGCGATCTTTCCACCGCAGCTTATCGGGGTCCCAAGCTGCCTAGTGTCCCTGACGACTTAGTAGTC
ACCGGCGTTCTCGACTTGGAATGTGACGAGCGGTTTTGGGTCCCCCAGGCCAAGGATGTTTGGTTTCGTCCGTTA
TGCTTCAATGTGTCCCACGGATACTTTGTGAACATCCTACGCGTCAGGAAGAGCGGAATCTTGTCACGCCACCGA
CACACAGGACCCGTCCATGCTACTGTTCTACGGGGTCGATGGCACTATCTTGAGCACCCTTGGTGGGCCGAGGAA
GGTGGATATGCCTTCGAGCCCCCCGGCGACATCCACACTTTGGAAGTGCCCGATGGGGTTCAGGAGATGATTACC
TTGTTCCACGTGACGGGCGCGTATATCTACGTGGATGTTGACGGCAAGGCATTGGGAATTGAGGATGTCTTCAGC
AAGCTTCAGGCAGCGCGGAAGCACTACGAGGAGGTTGGTCTGGGCGCCAGCTTTGCGGATCAGTTTGTGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail