Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g532.t1
Gene name
Locationscaffold_01:1360332..1364492
Strand+
Gene length (bp)4160
Transcript length (bp)4014
Coding sequence length (bp)4014
Protein length (aa) 1338

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04408 HA2 Helicase associated domain (HA2) 3.2E-16 999 1075
PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold 1.2E-14 1163 1264
PF05773 RWD RWD domain 7.3E-13 386 485
PF00271 Helicase_C Helicase conserved C-terminal domain 9.1E-13 812 934
PF00270 DEAD DEAD/DEAH box helicase 6.6E-10 564 729

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0005515 protein binding Yes
GO:0003676 nucleic acid binding Yes
GO:0004386 helicase activity Yes
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0140657 ATP-dependent activity No
GO:0030554 adenyl nucleotide binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 13.48 7.86 19.11
5d_25C Five days - 25 degrees Celsius 13.54 7.89 19.19
7d_25C Seven days - 25 degrees Celsius 10.73 6.03 15.43
10d_25C Ten days - 25 degrees Celsius 8.82 4.77 12.86
7d_15C Seven days - 15 degrees Celsius 14.88 8.75 21.00
7d_30C Seven days - 30 degrees Celsius 12.28 7.02 17.54

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.992023 no
3d_25C 7d_25C 0.391890 no
3d_25C 7d_15C 0.745705 no
3d_25C 7d_30C 0.772001 no
3d_25C 10d_25C 0.082459 no
5d_25C 7d_25C 0.381875 no
5d_25C 7d_15C 0.755838 no
5d_25C 7d_30C 0.756854 no
5d_25C 10d_25C 0.077167 no
7d_25C 7d_15C 0.176783 no
7d_25C 7d_30C 0.659928 no
7d_25C 10d_25C 0.508076 no
7d_15C 7d_30C 0.478388 no
7d_15C 10d_25C 0.025858 yes
7d_30C 10d_25C 0.204523 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g532.t1
MPPKKKGDGKGGPKPGTKQAKAVAEKAAGEVKKQVPEEPKKPSVKDVIGGASWTGKLPVNMLAEHCQKQKWEKPE
YNMIKTADGFVSSVTMKKIDPKTKELIVIPPIKLPPSHKQLAGQPTALEARHFAAAFALFRVCNMRNIHMMMPPT
YKKLWKEDFGEIKAAETREGKGWMYEADPFLAKQERESAAADLAKKRADRERAQAKEKASNAELGLGNGDARSKR
IWSQAPKVDMGTRIRRDIEGLLRQHTVWNPYGVKIPETEKKTIADEFTGLGFRRSHVEEATAECKDREEVLEWLL
IYVPDDDLPRWSLPEGYSAGVSLGSGDLAREGKVKRLASVGYPADMCSQILDRKHGDELAAAEHLQGTLTHGTQF
SAPSVADEDEEAWAEEATTLEAIFGERYHRISARICEINSEASDIPQNTIFRFQKPSAHYPTTPPVISIQAKGVP
AYIRLSAIRRAVQYAEENFTGESMIFNIMDWLEVNLPSIMENPGKLREISAVTASSVAETHQIPVRSSRKNRRGI
DWKIDSERSLAIRDAWEAKQDTAPQIEMNRKRKALPAWNIQHEIIHSINSNQVTIISGETGSGKSTQSVQFVLDD
MIQRGLGAAANIICTQPRRISALGLADRVSDERCAVVGDEVGYVIRGESKAKPGSTKITFVTTGVLLRRMQSGGD
ADGNVASSLADVSHVVVDEVHERSLDTDFLLALLRDVLNYRKDLKVILMSATLDAGIFMRYFGSQRSVGLVNIPG
RTFPVEDYYLDDVIRYTSFAPELAEGYEDEEEPPRGEETLGKALRSLGMGINYDLIAATVEYIDSQLGNQPGGIL
IFLPGTLEIDRCLKAVSRIPDMHPLPLHASLLPAEQRRVFQSAPRGKRKVIAATNVAETSITIEDVVAVIDTGRV
KETSYDPKDNMVRLQEVWASQAACKQRRGRAGRVRAGICYKLYTRKAEANMAQRPDPEIRRVPLEQLCLSVKSMK
GIDDVATFLANTITPPESIAVEGALSFLHRVGALDHDRLTALGRYLSMIPADLRCAKLMIYGSIFGCMEPCLTIA
AMLTVKSPFVSPREKRDEANAAKATFSRPGDGDLLTDLSAYQAWSERTRAQGGYWGTQSWCAANFLSHQTLRDIS
SNRAQFITSLKDAGVLPIQYSDASASAWNRNATNRNLIRALVAGAFQPQVAQISFPDKKFASSVTGTVEVDPDAR
TIKYFNQENGRVFIHPSSILFSAAGYPSAAAYLSYFTKMATSKVFIRDLTPFNSYSLLLFCGSIELDTVGRGLVV
DGWLRLRGWARIGVLVSRLRTMLDEALTERFDNPSVVSNGSSLADRVIEAVKKLIEFNGLDQ*
Coding >Pro_DTO377G3_2|g532.t1
ATGCCACCTAAGAAGAAAGGCGATGGTAAAGGTGGCCCCAAGCCGGGTACAAAACAAGCCAAAGCTGTGGCAGAG
AAAGCGGCCGGCGAAGTGAAGAAGCAAGTGCCGGAGGAGCCCAAGAAACCATCCGTGAAGGATGTCATTGGCGGC
GCATCATGGACAGGGAAGCTACCGGTCAATATGTTGGCAGAGCACTGTCAAAAGCAAAAGTGGGAAAAACCTGAG
TACAACATGATCAAAACTGCCGACGGCTTTGTATCATCCGTCACAATGAAGAAAATAGATCCCAAGACCAAGGAA
TTAATCGTGATCCCACCGATAAAGCTCCCTCCCTCCCATAAGCAACTTGCTGGGCAGCCGACAGCCCTCGAAGCG
CGCCATTTCGCTGCAGCGTTTGCTCTGTTCCGAGTGTGCAATATGCGCAATATTCATATGATGATGCCTCCAACT
TATAAGAAATTGTGGAAGGAGGACTTTGGAGAAATTAAAGCAGCAGAAACTCGGGAAGGCAAGGGCTGGATGTAC
GAGGCAGATCCATTCTTAGCCAAGCAAGAGAGAGAGAGCGCGGCCGCCGATTTGGCAAAGAAGCGAGCGGATCGT
GAAAGAGCCCAGGCAAAGGAGAAGGCCTCAAATGCGGAATTAGGACTAGGAAATGGGGATGCCAGGAGTAAACGT
ATCTGGTCACAAGCGCCCAAGGTGGATATGGGCACACGGATTCGACGAGATATCGAAGGCCTTTTGCGGCAACAT
ACAGTTTGGAACCCATATGGCGTGAAGATCCCGGAAACCGAAAAGAAAACCATCGCGGACGAATTCACCGGTCTA
GGGTTTCGTCGCAGCCATGTGGAAGAAGCTACAGCGGAATGCAAAGACCGCGAAGAGGTCTTGGAGTGGCTTCTC
ATCTATGTTCCTGATGATGACCTCCCACGATGGTCTCTGCCGGAAGGATATTCGGCTGGAGTCAGTCTTGGTTCT
GGTGATCTCGCCCGTGAGGGCAAAGTCAAACGGCTGGCATCTGTTGGCTATCCAGCCGACATGTGCTCTCAAATT
TTGGACAGGAAGCACGGCGACGAATTGGCCGCTGCTGAGCATCTGCAAGGCACTTTGACCCATGGAACTCAATTC
TCGGCCCCGTCAGTAGCCGACGAAGACGAGGAAGCTTGGGCAGAAGAAGCGACTACGTTAGAGGCTATCTTCGGG
GAACGTTATCACCGCATATCAGCCAGGATCTGCGAGATCAACAGCGAGGCATCGGATATTCCACAAAACACGATT
TTCCGCTTCCAAAAGCCCTCCGCCCACTATCCAACCACACCTCCTGTTATATCAATCCAGGCCAAGGGCGTCCCA
GCCTATATACGTCTTAGTGCGATCCGTCGGGCAGTGCAGTATGCCGAGGAAAACTTTACGGGTGAATCTATGATT
TTCAACATTATGGATTGGCTGGAGGTCAATCTGCCGAGCATCATGGAGAACCCGGGTAAATTGCGGGAGATTTCC
GCTGTGACGGCTTCGTCGGTAGCTGAGACCCACCAAATTCCTGTGCGTTCGAGTAGGAAGAATCGCAGAGGCATT
GACTGGAAGATTGACTCGGAACGAAGCTTGGCGATCCGTGATGCTTGGGAGGCCAAACAAGATACCGCGCCGCAG
ATCGAGATGAATCGGAAAAGAAAAGCACTTCCTGCATGGAATATCCAACATGAAATAATACACTCTATCAACTCA
AACCAGGTGACTATCATCTCGGGTGAGACTGGTAGTGGTAAAAGTACACAATCCGTACAGTTTGTGCTGGACGAC
ATGATCCAGCGAGGACTGGGAGCTGCTGCCAACATCATCTGCACGCAGCCACGACGAATCTCGGCCCTGGGTCTT
GCCGACAGAGTTAGCGATGAGCGGTGCGCAGTAGTCGGTGATGAAGTTGGATATGTGATCCGAGGCGAGTCGAAA
GCCAAACCTGGCTCAACAAAGATCACGTTTGTGACTACTGGTGTCTTGCTGCGCCGGATGCAATCCGGTGGCGAT
GCGGATGGCAATGTCGCAAGCTCCCTCGCGGACGTATCGCACGTGGTGGTCGATGAGGTCCACGAGCGAAGTCTA
GATACAGACTTCTTATTGGCGCTGCTGAGGGATGTTCTAAATTACCGCAAGGACCTGAAAGTCATTCTCATGAGT
GCCACCCTCGATGCTGGTATCTTCATGAGATACTTTGGCAGTCAGAGATCCGTTGGACTGGTGAACATTCCTGGC
CGAACATTCCCTGTCGAAGACTACTACCTGGATGACGTTATCCGGTACACATCATTTGCGCCAGAACTTGCCGAG
GGCTACGAGGACGAGGAAGAACCCCCTCGGGGAGAAGAAACACTTGGCAAAGCCCTGCGGAGCTTGGGCATGGGA
ATCAATTATGATTTGATCGCAGCGACTGTCGAATACATCGATTCTCAGCTAGGAAACCAGCCAGGAGGCATCTTA
ATCTTCCTCCCTGGTACATTGGAGATTGATAGGTGTCTGAAGGCAGTCAGTAGGATCCCCGATATGCATCCTCTG
CCATTACATGCCTCCTTGCTTCCAGCCGAACAACGACGAGTATTCCAGAGCGCGCCAAGAGGAAAGCGAAAGGTT
ATTGCCGCTACAAACGTCGCGGAGACCTCAATCACAATCGAGGATGTTGTCGCCGTCATTGACACCGGTCGAGTC
AAGGAAACGAGCTACGACCCAAAGGATAACATGGTCCGTCTCCAAGAAGTATGGGCATCACAAGCCGCTTGCAAA
CAGCGTCGTGGGCGAGCAGGTCGTGTCCGTGCAGGTATCTGCTATAAGCTCTACACCCGCAAAGCCGAAGCAAAT
ATGGCCCAACGACCAGACCCAGAGATCCGCCGTGTTCCCCTGGAGCAGCTGTGTCTGTCTGTGAAATCCATGAAA
GGCATTGACGACGTCGCCACCTTCCTAGCCAACACCATTACTCCACCGGAGAGCATAGCCGTTGAAGGCGCACTA
AGCTTCTTGCATCGCGTAGGCGCTCTAGACCACGACAGACTCACAGCACTGGGCCGCTACCTCTCCATGATCCCC
GCGGATCTTCGCTGCGCCAAGCTCATGATCTACGGCTCCATCTTCGGCTGCATGGAACCCTGCCTCACAATCGCA
GCCATGCTAACAGTCAAAAGTCCCTTCGTCTCACCACGTGAGAAACGCGACGAAGCTAACGCCGCCAAAGCAACC
TTCTCTCGCCCGGGTGACGGTGACCTCCTCACCGACCTCTCAGCATACCAAGCCTGGTCCGAGCGAACTCGCGCT
CAGGGCGGCTACTGGGGCACCCAGTCGTGGTGTGCCGCCAACTTCCTCTCCCACCAGACGCTGCGCGATATCTCC
TCCAACCGCGCGCAGTTCATTACCTCGCTCAAAGACGCAGGCGTCCTGCCAATCCAGTATTCCGATGCGTCGGCT
TCGGCCTGGAATCGCAACGCAACCAATCGCAACTTGATCCGCGCCCTTGTTGCTGGAGCCTTCCAACCTCAGGTC
GCGCAGATCTCATTCCCGGATAAGAAGTTCGCCAGCTCGGTTACTGGTACCGTCGAGGTGGATCCGGATGCTCGC
ACTATCAAGTACTTCAATCAGGAGAACGGCCGTGTCTTCATTCACCCCAGCTCCATCCTCTTCTCTGCGGCTGGC
TATCCTAGTGCCGCGGCATATCTCAGTTACTTTACCAAGATGGCTACCAGCAAGGTCTTCATCCGCGACCTCACC
CCTTTCAACTCGTACTCCCTCCTTCTATTCTGCGGCTCTATAGAACTCGACACTGTGGGTCGTGGACTAGTTGTA
GACGGCTGGCTCCGTCTACGCGGCTGGGCCCGGATCGGCGTACTTGTTTCGCGGCTTCGCACCATGCTAGATGAG
GCTCTTACGGAGCGGTTTGATAATCCTTCGGTTGTCTCCAATGGCAGCAGTCTTGCTGATAGAGTGATTGAGGCT
GTCAAAAAGTTGATTGAGTTTAATGGACTTGATCAATAA
Transcript >Pro_DTO377G3_2|g532.t1
ATGCCACCTAAGAAGAAAGGCGATGGTAAAGGTGGCCCCAAGCCGGGTACAAAACAAGCCAAAGCTGTGGCAGAG
AAAGCGGCCGGCGAAGTGAAGAAGCAAGTGCCGGAGGAGCCCAAGAAACCATCCGTGAAGGATGTCATTGGCGGC
GCATCATGGACAGGGAAGCTACCGGTCAATATGTTGGCAGAGCACTGTCAAAAGCAAAAGTGGGAAAAACCTGAG
TACAACATGATCAAAACTGCCGACGGCTTTGTATCATCCGTCACAATGAAGAAAATAGATCCCAAGACCAAGGAA
TTAATCGTGATCCCACCGATAAAGCTCCCTCCCTCCCATAAGCAACTTGCTGGGCAGCCGACAGCCCTCGAAGCG
CGCCATTTCGCTGCAGCGTTTGCTCTGTTCCGAGTGTGCAATATGCGCAATATTCATATGATGATGCCTCCAACT
TATAAGAAATTGTGGAAGGAGGACTTTGGAGAAATTAAAGCAGCAGAAACTCGGGAAGGCAAGGGCTGGATGTAC
GAGGCAGATCCATTCTTAGCCAAGCAAGAGAGAGAGAGCGCGGCCGCCGATTTGGCAAAGAAGCGAGCGGATCGT
GAAAGAGCCCAGGCAAAGGAGAAGGCCTCAAATGCGGAATTAGGACTAGGAAATGGGGATGCCAGGAGTAAACGT
ATCTGGTCACAAGCGCCCAAGGTGGATATGGGCACACGGATTCGACGAGATATCGAAGGCCTTTTGCGGCAACAT
ACAGTTTGGAACCCATATGGCGTGAAGATCCCGGAAACCGAAAAGAAAACCATCGCGGACGAATTCACCGGTCTA
GGGTTTCGTCGCAGCCATGTGGAAGAAGCTACAGCGGAATGCAAAGACCGCGAAGAGGTCTTGGAGTGGCTTCTC
ATCTATGTTCCTGATGATGACCTCCCACGATGGTCTCTGCCGGAAGGATATTCGGCTGGAGTCAGTCTTGGTTCT
GGTGATCTCGCCCGTGAGGGCAAAGTCAAACGGCTGGCATCTGTTGGCTATCCAGCCGACATGTGCTCTCAAATT
TTGGACAGGAAGCACGGCGACGAATTGGCCGCTGCTGAGCATCTGCAAGGCACTTTGACCCATGGAACTCAATTC
TCGGCCCCGTCAGTAGCCGACGAAGACGAGGAAGCTTGGGCAGAAGAAGCGACTACGTTAGAGGCTATCTTCGGG
GAACGTTATCACCGCATATCAGCCAGGATCTGCGAGATCAACAGCGAGGCATCGGATATTCCACAAAACACGATT
TTCCGCTTCCAAAAGCCCTCCGCCCACTATCCAACCACACCTCCTGTTATATCAATCCAGGCCAAGGGCGTCCCA
GCCTATATACGTCTTAGTGCGATCCGTCGGGCAGTGCAGTATGCCGAGGAAAACTTTACGGGTGAATCTATGATT
TTCAACATTATGGATTGGCTGGAGGTCAATCTGCCGAGCATCATGGAGAACCCGGGTAAATTGCGGGAGATTTCC
GCTGTGACGGCTTCGTCGGTAGCTGAGACCCACCAAATTCCTGTGCGTTCGAGTAGGAAGAATCGCAGAGGCATT
GACTGGAAGATTGACTCGGAACGAAGCTTGGCGATCCGTGATGCTTGGGAGGCCAAACAAGATACCGCGCCGCAG
ATCGAGATGAATCGGAAAAGAAAAGCACTTCCTGCATGGAATATCCAACATGAAATAATACACTCTATCAACTCA
AACCAGGTGACTATCATCTCGGGTGAGACTGGTAGTGGTAAAAGTACACAATCCGTACAGTTTGTGCTGGACGAC
ATGATCCAGCGAGGACTGGGAGCTGCTGCCAACATCATCTGCACGCAGCCACGACGAATCTCGGCCCTGGGTCTT
GCCGACAGAGTTAGCGATGAGCGGTGCGCAGTAGTCGGTGATGAAGTTGGATATGTGATCCGAGGCGAGTCGAAA
GCCAAACCTGGCTCAACAAAGATCACGTTTGTGACTACTGGTGTCTTGCTGCGCCGGATGCAATCCGGTGGCGAT
GCGGATGGCAATGTCGCAAGCTCCCTCGCGGACGTATCGCACGTGGTGGTCGATGAGGTCCACGAGCGAAGTCTA
GATACAGACTTCTTATTGGCGCTGCTGAGGGATGTTCTAAATTACCGCAAGGACCTGAAAGTCATTCTCATGAGT
GCCACCCTCGATGCTGGTATCTTCATGAGATACTTTGGCAGTCAGAGATCCGTTGGACTGGTGAACATTCCTGGC
CGAACATTCCCTGTCGAAGACTACTACCTGGATGACGTTATCCGGTACACATCATTTGCGCCAGAACTTGCCGAG
GGCTACGAGGACGAGGAAGAACCCCCTCGGGGAGAAGAAACACTTGGCAAAGCCCTGCGGAGCTTGGGCATGGGA
ATCAATTATGATTTGATCGCAGCGACTGTCGAATACATCGATTCTCAGCTAGGAAACCAGCCAGGAGGCATCTTA
ATCTTCCTCCCTGGTACATTGGAGATTGATAGGTGTCTGAAGGCAGTCAGTAGGATCCCCGATATGCATCCTCTG
CCATTACATGCCTCCTTGCTTCCAGCCGAACAACGACGAGTATTCCAGAGCGCGCCAAGAGGAAAGCGAAAGGTT
ATTGCCGCTACAAACGTCGCGGAGACCTCAATCACAATCGAGGATGTTGTCGCCGTCATTGACACCGGTCGAGTC
AAGGAAACGAGCTACGACCCAAAGGATAACATGGTCCGTCTCCAAGAAGTATGGGCATCACAAGCCGCTTGCAAA
CAGCGTCGTGGGCGAGCAGGTCGTGTCCGTGCAGGTATCTGCTATAAGCTCTACACCCGCAAAGCCGAAGCAAAT
ATGGCCCAACGACCAGACCCAGAGATCCGCCGTGTTCCCCTGGAGCAGCTGTGTCTGTCTGTGAAATCCATGAAA
GGCATTGACGACGTCGCCACCTTCCTAGCCAACACCATTACTCCACCGGAGAGCATAGCCGTTGAAGGCGCACTA
AGCTTCTTGCATCGCGTAGGCGCTCTAGACCACGACAGACTCACAGCACTGGGCCGCTACCTCTCCATGATCCCC
GCGGATCTTCGCTGCGCCAAGCTCATGATCTACGGCTCCATCTTCGGCTGCATGGAACCCTGCCTCACAATCGCA
GCCATGCTAACAGTCAAAAGTCCCTTCGTCTCACCACGTGAGAAACGCGACGAAGCTAACGCCGCCAAAGCAACC
TTCTCTCGCCCGGGTGACGGTGACCTCCTCACCGACCTCTCAGCATACCAAGCCTGGTCCGAGCGAACTCGCGCT
CAGGGCGGCTACTGGGGCACCCAGTCGTGGTGTGCCGCCAACTTCCTCTCCCACCAGACGCTGCGCGATATCTCC
TCCAACCGCGCGCAGTTCATTACCTCGCTCAAAGACGCAGGCGTCCTGCCAATCCAGTATTCCGATGCGTCGGCT
TCGGCCTGGAATCGCAACGCAACCAATCGCAACTTGATCCGCGCCCTTGTTGCTGGAGCCTTCCAACCTCAGGTC
GCGCAGATCTCATTCCCGGATAAGAAGTTCGCCAGCTCGGTTACTGGTACCGTCGAGGTGGATCCGGATGCTCGC
ACTATCAAGTACTTCAATCAGGAGAACGGCCGTGTCTTCATTCACCCCAGCTCCATCCTCTTCTCTGCGGCTGGC
TATCCTAGTGCCGCGGCATATCTCAGTTACTTTACCAAGATGGCTACCAGCAAGGTCTTCATCCGCGACCTCACC
CCTTTCAACTCGTACTCCCTCCTTCTATTCTGCGGCTCTATAGAACTCGACACTGTGGGTCGTGGACTAGTTGTA
GACGGCTGGCTCCGTCTACGCGGCTGGGCCCGGATCGGCGTACTTGTTTCGCGGCTTCGCACCATGCTAGATGAG
GCTCTTACGGAGCGGTTTGATAATCCTTCGGTTGTCTCCAATGGCAGCAGTCTTGCTGATAGAGTGATTGAGGCT
GTCAAAAAGTTGATTGAGTTTAATGGACTTGATCAATAA
Gene >Pro_DTO377G3_2|g532.t1
ATGCCACCTAAGAAGAAAGGCGATGGTAAAGGTGGCCCCAAGCCGGGTACAAAACAAGCCAAAGCTGTGGCAGAG
AAAGCGGCCGGCGAAGTGAAGAAGCAAGTGCCGGAGGAGCCCAAGAAACCATCCGTGAAGGATGTCATTGGCGGC
GCATCATGGACAGGGAAGCTACCGGTCAATATGTTGGCAGAGCACTGTCAAAAGCAAAAGTGGGAAAAACCTGAG
TACAACATGGTAATCAACTTCCCATGGCACTCGTCGCCTGTTTACAAACACATATATCAAACCAGATGCTGATAG
GTTGCGACAATTGCAGATCAAAACTGCCGACGGCTTTGTATCATCCGTCACAATGAAGAAAATAGATCCCAAGAC
CAAGGAATTAATCGTGATCCCACCGATAAAGCTCCCTCCCTCCCATAAGCAACTTGCTGGGCAGCCGACAGCCCT
CGAAGCGCGCCATTTCGCTGCAGCGTTTGCTCTGTTCCGAGTGTGCAATATGCGCAATATTCATATGATGATGCC
TCCAACTTATAAGAAATTGTGGAAGGAGGACTTTGGAGAAATTAAAGCAGCAGAAACTCGGGAAGGCAAGGGCTG
GATGTACGAGGCAGATCCATTCTTAGCCAAGCAAGAGAGAGAGAGCGCGGCCGCCGATTTGGCAAAGAAGCGAGC
GGATCGTGAAAGAGCCCAGGCAAAGGAGAAGGCCTCAAATGCGGAATTAGGACTAGGAAATGGGGATGCCAGGAG
TAAACGTATCTGGTCACAAGCGCCCAAGGTGGATATGGGCACACGGATTCGACGAGATATCGAAGGCCTTTTGCG
GCAACATACAGTTTGGAACCCATATGGCGTGAAGATCCCGGAAACCGAAAAGAAAACCATCGCGGACGAATTCAC
CGGTCTAGGGTTTCGTCGCAGCCATGTGGAAGAAGCTACAGCGGAATGCAAAGACCGCGAAGAGGTCTTGGAGTG
GCTTCTCATCTATGTTCCTGATGATGACCTCCCACGATGGTCTCTGCCGGAAGGATATTCGGCTGGAGTCAGTCT
TGGTTCTGGTGATCTCGCCCGTGAGGGCAAAGTCAAACGGCTGGCATCTGTTGGCTATCCAGCCGACATGTGCTC
TCAAATTTTGGACAGGAAGCACGGCGACGAATTGGCCGCTGCTGAGCATCTGCAAGGCACTTTGACCCATGGAAC
TCAATTCTCGGCCCCGTCAGTAGCCGACGAAGACGAGGAAGCTTGGGCAGAAGAAGCGACTACGTTAGAGGCTAT
CTTCGGGGAACGTTATCACCGCATATCAGCCAGGATCTGCGAGATCAACAGCGAGGCATCGGATATTCCACAAAA
CACGATTTTCCGCTTCCAAAAGCCCTCCGCCCACTATCCAACCACACCTCCTGTTATATCAATCCAGGCCAAGGG
CGTCCCAGCCTATATACGTCTTAGTGCGATCCGTCGGGCAGTGCAGTATGCCGAGGAAAACTTTACGGGTGAATC
TATGATTTTCAACATTATGGATTGGCTGGAGGTCAATCTGCCGAGCATCATGGAGAACCCGGGTAAATTGCGGGA
GATTTCCGCTGTGACGGCTTCGTCGGTAGCTGAGACCCACCAAATTCCTGTGCGTTCGAGTAGGAAGAATCGCAG
AGGCATTGACTGGAAGATTGACTCGGAACGAAGCTTGGCGATCCGTGATGCTTGGGAGGCCAAACAAGATACCGC
GCCGCAGATCGAGATGAATCGGAAAAGAAAAGCACTTCCTGCATGGAATATCCAACATGAAATAATACACTCTAT
CAACTCAAACCAGGTGACTATCATCTCGGGTGAGACTGGTAGTGGTAAAAGTACACAATCCGTACAGTTTGTGCT
GGACGACATGATCCAGCGAGGACTGGGAGCTGCTGCCAACATCATCTGCACGCAGCCACGACGAATCTCGGCCCT
GGGTCTTGCCGACAGAGTTAGCGATGAGCGGTGCGCAGTAGTCGGTGATGAAGTTGGATATGTGATCCGAGGCGA
GTCGAAAGCCAAACCTGGCTCAACAAAGATCACGTTTGTGACTACTGGTGTCTTGCTGCGCCGGATGCAATCCGG
TGGCGATGCGGATGGCAATGTCGCAAGCTCCCTCGCGGACGTATCGCACGTGGTGGTCGATGAGGTCCACGAGCG
AAGTCTAGATACAGACTTCTTATTGGCGCTGCTGAGGGATGTTCTAAATTACCGCAAGGACCTGAAAGTCATTCT
CATGAGTGCCACCCTCGATGCTGGTATCTTCATGAGATACTTTGGCAGTCAGAGATCCGTTGGACTGGTGAACAT
TCCTGGCCGAACATTCCCTGTCGAAGACTACTACCTGGATGACGTTATCCGGTACACATCATTTGCGCCAGAACT
TGCCGAGGGCTACGAGGACGAGGAAGAACCCCCTCGGGGAGAAGAAACACTTGGCAAAGCCCTGCGGAGCTTGGG
CATGGGAATCAATTATGATTTGATCGCAGCGACTGTCGAATACATCGATTCTCAGCTAGGAAACCAGCCAGGAGG
CATCTTAATCTTCCTCCCTGGTACATTGGAGATTGATAGGTGTCTGAAGGCAGTCAGTAGGATCCCCGATATGCA
TCCTCTGCCATTACATGCCTCCTTGCTTCCAGCCGAACAACGACGAGTATTCCAGAGCGCGCCAAGAGGAAAGCG
AAAGGTTATTGCCGCTACAAACGTCGCGGAGACCTCAATCACAATCGAGGATGTTGTCGCCGTCATTGACACCGG
TCGAGTCAAGGAAACGAGCTACGACCCAAAGGATAACATGGTCCGTCTCCAAGAAGTATGGGCATCACAAGCCGC
TTGCAAACAGCGTCGTGGGCGAGCAGGTCGTGTCCGTGCAGGTATCTGCTATAAGCTCTACACCCGCAAAGCCGA
AGCAAATATGGCCCAACGACCAGACCCAGAGATCCGCCGTGTTCCCCTGGAGCAGCTGTGTCTGTCTGTGAAATC
CATGAAAGGCATTGACGACGTCGCCACCTTCCTAGCCAACACCATTACTCCACCGGAGAGCATAGCCGTTGAAGG
CGCACTAAGCTTCTTGCATCGCGTAGGCGCTCTAGACCACGACAGACTCACAGCACTGGGCCGCTACCTCTCCAT
GATCCCCGCGGATCTTCGCTGCGCCAAGCTCATGATCTACGGCTCCATCTTCGGCTGCATGGAACCCTGCCTCAC
AATCGCAGCCATGCTAACAGTCAAAAGTCCCTTCGTCTCACCACGTGAGAAACGCGACGAAGCTAACGCCGCCAA
AGCAACCTTCTCTCGCCCGGGTGACGGTGACCTCCTCACCGACCTCTCAGCATACCAAGCCTGGTCCGAGCGAAC
TCGCGCTCAGGGCGGCTACTGGGGCACCCAGTCGTGGTGTGCCGCCAACTTCCTCTCCCACCAGACGCTGCGCGA
TATCTCCTCCAACCGCGCGCAGTTCATTACCTCGCTCAAAGACGCAGGCGTCCTGCCAATCCAGTATTCCGATGC
GTCGGCTTCGGCCTGGAATCGCAACGCAACCAATCGCAACTTGATCCGCGCCCTTGTTGCTGGAGCCTTCCAACC
TCAGGTCGCGCAGATCTCATTCCCGGATAAGAAGTTCGCCAGCTCGGTTACTGGTACCGTCGAGGTGGATCCGGA
TGCTCGCACTATCAAGTACTTCAATCAGGAGAACGGCCGTGTCTTCATTCACCCCAGCTCCATCCTCTTCTCTGC
GGCTGGCTATCCTAGTGCCGCGGCATATCTCAGTTACTTTACCAAGATGGCTACCAGCAAGGTCTTCATCCGCGA
CCTCACCCGTGGGTTACTTCTCTTCCTTTCCTCGGGGTATCACCTTCTAACCTTCTTTTTTCTTACTTGCAGCTT
TCAACTCGTACTCCCTCCTTCTATTCTGCGGCTCTATAGAACTCGACACTGTGGGTCGTGGACTAGTTGTAGACG
GCTGGCTCCGTCTACGCGGCTGGGCCCGGATCGGCGTACTTGTTTCGCGGCTTCGCACCATGCTAGATGAGGCTC
TTACGGAGCGGTTTGATAATCCTTCGGTTGTCTCCAATGGCAGCAGTCTTGCTGATAGAGTGATTGAGGCTGTCA
AAAAGTTGATTGAGTTTAATGGACTTGATCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail