Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5312.t1
Gene name
Locationscaffold_12:452169..454001
Strand-
Gene length (bp)1832
Transcript length (bp)1749
Coding sequence length (bp)1749
Protein length (aa) 583

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02733 Dak1 Dak1 domain 6.9E-89 22 321
PF02734 Dak2 DAK2 domain 4.8E-37 406 577

GO

GO Term Description Terminal node
GO:0004371 glycerone kinase activity Yes
GO:0006071 glycerol metabolic process Yes
GO:0044262 cellular carbohydrate metabolic process No
GO:0016301 kinase activity No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0006066 alcohol metabolic process No
GO:0019751 polyol metabolic process No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:0019400 alditol metabolic process No
GO:0003824 catalytic activity No
GO:0005975 carbohydrate metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5312.t1
MSDKHYFPSTSANSLVPRALRALVSANDHLSLNYTERVVSNAFHDDSKVSIISGGGSGHEPAWSGYVGDGLLSAV
ACGDIFASPSAKQILAAIRTAPSKKGTILLITNYTGDRLHFGLAAERAKAEGLVENIAILHATDDVSIGRSKNSH
MAMKIIGAAASEGYSFKQCLALGQAINGQTVTIASALDHCHVPGRHQQSSVPDNVVVVGAGIHNEPGQLHLSPAP
PVEQLIEQCLKFLCDDSDTERAFVKFEPRDEIGLLVNNYGGLSVLELSALTDEIQCQLSSRWNIRPCKTLFGSFE
TSLNAPGFSISLCNLTAAARQSNQSVATLIRHFDCPTTAVSWPNTSRPSPSQQKTTFDDLDAEVNSQITASPRIK
FDPLLLEKALRTSCERAIAAEPRLTQWDMVMGDGDCGEAVQGLAESVLQSVDKGCTASGDLLEVIRSVLQNVDDM
GGTLGAIFGVLLSALYTALRKNSLEGICPNTPNFYSTALASATTTLKSHTGAREGDRTVMDVLLPFSEEFSKTND
FLSAVDVAAKKAEETRHLKAKFGRATYVGDASSQQLPDPGAWALYEIVAGLADGLGL*
Coding >Pro_DTO377G3_2|g5312.t1
ATGTCCGACAAACACTACTTCCCCTCAACAAGCGCCAATTCTTTGGTCCCAAGAGCGCTGCGAGCTCTTGTCTCC
GCAAACGATCACTTGAGTTTGAACTACACAGAGAGAGTAGTTTCCAATGCGTTTCATGATGACTCAAAGGTGAGC
ATTATCAGCGGAGGCGGCTCAGGACACGAACCGGCGTGGAGTGGCTATGTTGGTGATGGCCTGCTATCAGCTGTT
GCGTGCGGTGATATCTTTGCGTCACCAAGCGCAAAGCAAATCCTGGCTGCGATTCGGACGGCCCCATCGAAGAAA
GGGACTATACTACTCATAACCAATTACACTGGAGATCGTCTTCACTTCGGCCTTGCGGCCGAGAGAGCTAAGGCT
GAAGGTCTGGTTGAAAATATTGCCATTCTACATGCTACAGATGATGTCTCCATTGGAAGAAGTAAAAATAGCCAC
ATGGCAATGAAGATCATCGGGGCAGCTGCCTCGGAGGGTTACTCTTTCAAACAGTGTCTTGCACTGGGACAAGCA
ATAAATGGGCAGACGGTTACGATCGCCTCGGCTCTTGACCATTGCCATGTTCCAGGCAGACACCAACAATCATCC
GTCCCAGACAATGTGGTTGTCGTCGGCGCCGGTATACATAATGAGCCCGGCCAACTTCATCTTTCCCCCGCCCCC
CCTGTCGAGCAACTTATTGAGCAGTGTCTCAAATTCCTTTGCGATGATTCCGATACAGAGCGAGCATTTGTCAAG
TTTGAGCCACGCGATGAAATTGGTTTACTGGTCAACAACTATGGTGGCCTCTCTGTCCTCGAGTTATCTGCTCTG
ACCGATGAGATCCAATGTCAGTTAAGCTCACGATGGAACATCAGGCCTTGCAAAACATTATTTGGTTCATTTGAA
ACGTCTCTCAACGCGCCAGGCTTTTCGATTTCTCTCTGCAACCTTACCGCCGCAGCTCGGCAATCGAATCAATCT
GTCGCGACCTTGATACGGCACTTTGATTGTCCCACCACTGCTGTCTCTTGGCCAAACACCTCCCGTCCCTCTCCT
TCTCAACAGAAGACCACCTTCGATGATCTCGATGCCGAGGTAAACAGCCAAATTACCGCTTCCCCTCGCATCAAA
TTTGACCCTTTACTATTGGAGAAAGCCTTAAGGACCTCGTGCGAAAGAGCCATTGCAGCAGAGCCAAGGCTGACC
CAGTGGGACATGGTCATGGGCGATGGAGACTGTGGCGAGGCAGTCCAAGGCTTGGCCGAATCAGTCCTGCAAAGT
GTCGATAAAGGCTGCACAGCCTCAGGCGATCTGCTAGAGGTAATTCGGTCTGTGTTGCAGAATGTCGACGACATG
GGTGGAACCCTCGGTGCAATTTTTGGAGTTCTTCTTTCCGCTCTTTATACAGCCCTGAGAAAGAATTCGCTCGAG
GGAATCTGCCCTAATACGCCAAACTTCTATTCAACTGCTCTGGCGTCCGCGACGACAACCCTGAAGTCGCACACG
GGAGCAAGGGAAGGAGACCGTACTGTTATGGACGTTTTACTCCCTTTCAGCGAGGAGTTTTCGAAAACAAATGAT
TTTCTGTCAGCAGTGGATGTGGCTGCTAAAAAGGCGGAGGAAACAAGACATCTCAAGGCCAAGTTCGGCCGAGCA
ACGTATGTCGGGGATGCCTCAAGTCAGCAACTCCCAGACCCCGGGGCTTGGGCTTTGTATGAGATAGTTGCGGGC
TTGGCGGATGGACTTGGGCTTTAG
Transcript >Pro_DTO377G3_2|g5312.t1
ATGTCCGACAAACACTACTTCCCCTCAACAAGCGCCAATTCTTTGGTCCCAAGAGCGCTGCGAGCTCTTGTCTCC
GCAAACGATCACTTGAGTTTGAACTACACAGAGAGAGTAGTTTCCAATGCGTTTCATGATGACTCAAAGGTGAGC
ATTATCAGCGGAGGCGGCTCAGGACACGAACCGGCGTGGAGTGGCTATGTTGGTGATGGCCTGCTATCAGCTGTT
GCGTGCGGTGATATCTTTGCGTCACCAAGCGCAAAGCAAATCCTGGCTGCGATTCGGACGGCCCCATCGAAGAAA
GGGACTATACTACTCATAACCAATTACACTGGAGATCGTCTTCACTTCGGCCTTGCGGCCGAGAGAGCTAAGGCT
GAAGGTCTGGTTGAAAATATTGCCATTCTACATGCTACAGATGATGTCTCCATTGGAAGAAGTAAAAATAGCCAC
ATGGCAATGAAGATCATCGGGGCAGCTGCCTCGGAGGGTTACTCTTTCAAACAGTGTCTTGCACTGGGACAAGCA
ATAAATGGGCAGACGGTTACGATCGCCTCGGCTCTTGACCATTGCCATGTTCCAGGCAGACACCAACAATCATCC
GTCCCAGACAATGTGGTTGTCGTCGGCGCCGGTATACATAATGAGCCCGGCCAACTTCATCTTTCCCCCGCCCCC
CCTGTCGAGCAACTTATTGAGCAGTGTCTCAAATTCCTTTGCGATGATTCCGATACAGAGCGAGCATTTGTCAAG
TTTGAGCCACGCGATGAAATTGGTTTACTGGTCAACAACTATGGTGGCCTCTCTGTCCTCGAGTTATCTGCTCTG
ACCGATGAGATCCAATGTCAGTTAAGCTCACGATGGAACATCAGGCCTTGCAAAACATTATTTGGTTCATTTGAA
ACGTCTCTCAACGCGCCAGGCTTTTCGATTTCTCTCTGCAACCTTACCGCCGCAGCTCGGCAATCGAATCAATCT
GTCGCGACCTTGATACGGCACTTTGATTGTCCCACCACTGCTGTCTCTTGGCCAAACACCTCCCGTCCCTCTCCT
TCTCAACAGAAGACCACCTTCGATGATCTCGATGCCGAGGTAAACAGCCAAATTACCGCTTCCCCTCGCATCAAA
TTTGACCCTTTACTATTGGAGAAAGCCTTAAGGACCTCGTGCGAAAGAGCCATTGCAGCAGAGCCAAGGCTGACC
CAGTGGGACATGGTCATGGGCGATGGAGACTGTGGCGAGGCAGTCCAAGGCTTGGCCGAATCAGTCCTGCAAAGT
GTCGATAAAGGCTGCACAGCCTCAGGCGATCTGCTAGAGGTAATTCGGTCTGTGTTGCAGAATGTCGACGACATG
GGTGGAACCCTCGGTGCAATTTTTGGAGTTCTTCTTTCCGCTCTTTATACAGCCCTGAGAAAGAATTCGCTCGAG
GGAATCTGCCCTAATACGCCAAACTTCTATTCAACTGCTCTGGCGTCCGCGACGACAACCCTGAAGTCGCACACG
GGAGCAAGGGAAGGAGACCGTACTGTTATGGACGTTTTACTCCCTTTCAGCGAGGAGTTTTCGAAAACAAATGAT
TTTCTGTCAGCAGTGGATGTGGCTGCTAAAAAGGCGGAGGAAACAAGACATCTCAAGGCCAAGTTCGGCCGAGCA
ACGTATGTCGGGGATGCCTCAAGTCAGCAACTCCCAGACCCCGGGGCTTGGGCTTTGTATGAGATAGTTGCGGGC
TTGGCGGATGGACTTGGGCTTTAG
Gene >Pro_DTO377G3_2|g5312.t1
ATGTCCGACAAACACTACTTCCCCTCAACAAGCGCCAATTCTTTGGTCCCAAGAGCGCTGCGAGCTCTTGTCTCC
GCAAACGATCACTTGAGTTTGAACTACACAGAGAGAGTAGTTTCCAATGCGTTTCATGATGACTCAAAGGTGAGC
ATTATCAGCGGAGGCGGCTCAGGACACGAACCGGCGTGGAGTGGCTATGTTGGTGATGGCCTGCTATCAGCTGTT
GCGTGCGGTGATATCTTTGCGTCACCAAGCGCAAAGCAAATCCTGGCTGCGATTCGGACGGCCCCATCGAAGAAA
GGGACTATACTACTCATAACCAATTACACTGGAGATCGTCTTCACTTCGGCCTTGCGGCCGAGAGAGCTAAGGCT
GAAGGTCTGGTTGAAAATATTGCCATTCTACATGCTACAGATGATGTCTCCATTGGAAGAAGTAAAAATAGCCAC
ATGGGTAGGAGAGGGCTACCTGGTCATATTTTTAGTAAGATTGTTACTTGTTCCCTGGTTTGATGGCTGCTGATG
GATACGCCGTAGCAATGAAGATCATCGGGGCAGCTGCCTCGGAGGGTTACTCTTTCAAACAGTGTCTTGCACTGG
GACAAGCAATAAATGGGCAGACGGTTACGATCGCCTCGGCTCTTGACCATTGCCATGTTCCAGGCAGACACCAAC
AATCATCCGTCCCAGACAATGTGGTTGTCGTCGGCGCCGGTATACATAATGAGCCCGGCCAACTTCATCTTTCCC
CCGCCCCCCCTGTCGAGCAACTTATTGAGCAGTGTCTCAAATTCCTTTGCGATGATTCCGATACAGAGCGAGCAT
TTGTCAAGTTTGAGCCACGCGATGAAATTGGTTTACTGGTCAACAACTATGGTGGCCTCTCTGTCCTCGAGTTAT
CTGCTCTGACCGATGAGATCCAATGTCAGTTAAGCTCACGATGGAACATCAGGCCTTGCAAAACATTATTTGGTT
CATTTGAAACGTCTCTCAACGCGCCAGGCTTTTCGATTTCTCTCTGCAACCTTACCGCCGCAGCTCGGCAATCGA
ATCAATCTGTCGCGACCTTGATACGGCACTTTGATTGTCCCACCACTGCTGTCTCTTGGCCAAACACCTCCCGTC
CCTCTCCTTCTCAACAGAAGACCACCTTCGATGATCTCGATGCCGAGGTAAACAGCCAAATTACCGCTTCCCCTC
GCATCAAATTTGACCCTTTACTATTGGAGAAAGCCTTAAGGACCTCGTGCGAAAGAGCCATTGCAGCAGAGCCAA
GGCTGACCCAGTGGGACATGGTCATGGGCGATGGAGACTGTGGCGAGGCAGTCCAAGGCTTGGCCGAATCAGTCC
TGCAAAGTGTCGATAAAGGCTGCACAGCCTCAGGCGATCTGCTAGAGGTAATTCGGTCTGTGTTGCAGAATGTCG
ACGACATGGGTGGAACCCTCGGTGCAATTTTTGGAGTTCTTCTTTCCGCTCTTTATACAGCCCTGAGAAAGAATT
CGCTCGAGGGAATCTGCCCTAATACGCCAAACTTCTATTCAACTGCTCTGGCGTCCGCGACGACAACCCTGAAGT
CGCACACGGGAGCAAGGGAAGGAGACCGTACTGTTATGGACGTTTTACTCCCTTTCAGCGAGGAGTTTTCGAAAA
CAAATGATTTTCTGTCAGCAGTGGATGTGGCTGCTAAAAAGGCGGAGGAAACAAGACATCTCAAGGCCAAGTTCG
GCCGAGCAACGTATGTCGGGGATGCCTCAAGTCAGCAACTCCCAGACCCCGGGGCTTGGGCTTTGTATGAGATAG
TTGCGGGCTTGGCGGATGGACTTGGGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail