Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5305.t1
Gene name
Locationscaffold_12:438629..439148
Strand+
Gene length (bp)519
Transcript length (bp)459
Coding sequence length (bp)459
Protein length (aa) 153

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00636 Ribonuclease_3 Ribonuclease III domain 1.4E-07 50 132

GO

GO Term Description Terminal node
GO:0004525 ribonuclease III activity Yes
GO:0006396 RNA processing Yes
GO:0016893 endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters No
GO:0004540 ribonuclease activity No
GO:0046483 heterocycle metabolic process No
GO:0016891 endoribonuclease activity, producing 5'-phosphomonoesters No
GO:0090304 nucleic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No
GO:0004521 endoribonuclease activity No
GO:0044238 primary metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0004519 endonuclease activity No
GO:0008152 metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0004518 nuclease activity No
GO:0032296 double-stranded RNA-specific ribonuclease activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016070 RNA metabolic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5305.t1
MELGRYIFQLPSDEELQVLEQKINYSFSNRTLLREALQPATWVNEDGNKKLAMVGNSIMRLVIVNHGLKGKKTRG
QISDMFTLKASKSSLCAQGFYLGISKFVVKRPTQLVVGPTIMATTMEAIVGAVYLDCNEQIQPCAVVMNALDIAW
SE*
Coding >Pro_DTO377G3_2|g5305.t1
ATGGAACTCGGACGTTATATCTTCCAGTTACCCTCGGACGAGGAACTCCAGGTCTTGGAGCAGAAGATCAACTAT
TCTTTTTCCAACCGAACTCTGCTCCGGGAGGCACTCCAACCCGCGACCTGGGTTAACGAAGATGGCAATAAGAAA
CTTGCAATGGTGGGCAATTCAATTATGCGCCTGGTAATTGTGAATCACGGCCTCAAAGGAAAGAAGACGCGTGGT
CAAATCTCCGATATGTTCACCCTTAAGGCTAGCAAATCCTCTCTTTGTGCGCAGGGCTTCTATCTCGGTATTTCC
AAATTTGTCGTCAAAAGACCTACCCAATTAGTCGTTGGACCGACTATCATGGCGACCACCATGGAGGCAATCGTC
GGGGCAGTCTACCTTGACTGCAATGAGCAGATCCAGCCGTGTGCCGTTGTCATGAATGCATTGGATATTGCTTGG
TCTGAGTAA
Transcript >Pro_DTO377G3_2|g5305.t1
ATGGAACTCGGACGTTATATCTTCCAGTTACCCTCGGACGAGGAACTCCAGGTCTTGGAGCAGAAGATCAACTAT
TCTTTTTCCAACCGAACTCTGCTCCGGGAGGCACTCCAACCCGCGACCTGGGTTAACGAAGATGGCAATAAGAAA
CTTGCAATGGTGGGCAATTCAATTATGCGCCTGGTAATTGTGAATCACGGCCTCAAAGGAAAGAAGACGCGTGGT
CAAATCTCCGATATGTTCACCCTTAAGGCTAGCAAATCCTCTCTTTGTGCGCAGGGCTTCTATCTCGGTATTTCC
AAATTTGTCGTCAAAAGACCTACCCAATTAGTCGTTGGACCGACTATCATGGCGACCACCATGGAGGCAATCGTC
GGGGCAGTCTACCTTGACTGCAATGAGCAGATCCAGCCGTGTGCCGTTGTCATGAATGCATTGGATATTGCTTGG
TCTGAGTAA
Gene >Pro_DTO377G3_2|g5305.t1
ATGGAACTCGGACGTTATATCTTCCAGTTACCCTCGGACGAGGAACTCCAGGTCTTGGAGCAGAAGATCAACTAT
TCTTTTTCCAACCGAACTCTGCTCCGGGAGGCACTCCAACCCGCGACCTGGGTTAACGAAGATGGCAATAAGAAA
CTTGCAATGGTGGGCAATTCAATTATGCGCCTGGTAATTGTGAATCACGGCCTCAAAGGAAAGAAGACGCGTGGT
ATGTGTTTCTCTCACACTGGCTACTATTTCACAAACTTACGATTTCGGCTCTGGTTAGGTCAAATCTCCGATATG
TTCACCCTTAAGGCTAGCAAATCCTCTCTTTGTGCGCAGGGCTTCTATCTCGGTATTTCCAAATTTGTCGTCAAA
AGACCTACCCAATTAGTCGTTGGACCGACTATCATGGCGACCACCATGGAGGCAATCGTCGGGGCAGTCTACCTT
GACTGCAATGAGCAGATCCAGCCGTGTGCCGTTGTCATGAATGCATTGGATATTGCTTGGTCTGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail