Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5302.t1
Gene name
Locationscaffold_12:430119..432593
Strand+
Gene length (bp)2474
Transcript length (bp)2157
Coding sequence length (bp)2157
Protein length (aa) 719

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00664 ABC_membrane ABC transporter transmembrane region 3.1E-39 138 412
PF00005 ABC_tran ABC transporter 3.5E-33 475 624

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005524 ATP binding Yes
GO:0140359 ABC-type transporter activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0030554 adenyl nucleotide binding No
GO:0005575 cellular_component No
GO:0015399 primary active transmembrane transporter activity No
GO:0140657 ATP-dependent activity No
GO:0022804 active transmembrane transporter activity No
GO:0017076 purine nucleotide binding No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0043167 ion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 132 154 22
2 164 186 22
3 247 269 22
4 279 301 22
5 372 394 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 74.36 45.65 103.06
5d_25C Five days - 25 degrees Celsius 76.66 47.06 106.25
7d_25C Seven days - 25 degrees Celsius 71.92 43.88 99.96
10d_25C Ten days - 25 degrees Celsius 68.33 41.94 94.72
7d_15C Seven days - 15 degrees Celsius 97.78 58.08 137.49
7d_30C Seven days - 30 degrees Celsius 51.08 31.12 71.05

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.923229 no
3d_25C 7d_25C 0.920503 no
3d_25C 7d_15C 0.228456 no
3d_25C 7d_30C 0.069866 no
3d_25C 10d_25C 0.760822 no
5d_25C 7d_25C 0.837280 no
5d_25C 7d_15C 0.307219 no
5d_25C 7d_30C 0.048822 yes
5d_25C 10d_25C 0.667435 no
7d_25C 7d_15C 0.175287 no
7d_25C 7d_30C 0.114354 no
7d_25C 10d_25C 0.868787 no
7d_15C 7d_30C 0.001278 yes
7d_15C 10d_25C 0.102281 no
7d_30C 10d_25C 0.191925 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5302.t1
MLLRAARSPCWRTAQFTYPSFAGKPRSTRLNGTHLRAFTSNKSSLWSQSTDTDKKDHASVKATPTSTPASSQLAD
ANIIQKPEGSGNAKTPPKKDLLSEPMAGKKEQRKADWAIMKEMAKYLWPKDDWGTKLRVGTALSLLIGAKILNVE
IPFYFKNIVDSMNIDFATVGGTAYTVAGSMIIAYGVTRIGATLFQELRNAVFASVAQKAIRKVASNVFEHLLRLD
LNFHLSRQTGGLTRAIDRGTKGISFLLTSMVFHVVPTALEISLVCGILTYQYGLQFAAITTTTMIAYTVFTITTT
AWRTKFRRQANAADNRGATVAVDSLINYEAVKYFNNEKFEVARYDKALKKYEDASIKVTTSLAFLNSGQNMIFSS
ALAAMMYLACNGVANGTMTVGDLVMVNQLVFQLSVPLNFLGSVYRELRQSLLDMETLFNLQKVNVTIKERPNAKP
LQLTQGGQIRFENVTFGYHPERPILKNATFTIPAGQKFAIVGPSGCGKSTILRLLFRFYDVQSGRILIDGQDIRD
VTVDSLRKAIGVVPQDTPLFNDTIAHNIRYGRIDASDEEVRRAAERAHIHKLIEGLPDGYQTAVGERGMMISGGE
KQRLAISRLILKDPKLFFFDEATSALDTYTEQALLQNINSILKEKSRTSVFVAHRLRTISDSDQILVLKEGHVAE
MGSHRELLEHDGTYAELWNTQEQTMAHDGSLEQSQVEDVQPKA*
Coding >Pro_DTO377G3_2|g5302.t1
ATGCTGCTCAGAGCCGCACGATCGCCGTGCTGGCGCACAGCACAATTCACCTATCCGAGCTTCGCCGGCAAGCCA
CGAAGCACACGACTCAATGGAACACACCTGCGCGCATTCACATCAAATAAGAGTTCATTATGGAGTCAATCCACA
GACACAGACAAGAAAGATCACGCATCTGTCAAAGCTACTCCTACCTCTACTCCCGCCTCATCACAACTAGCAGAC
GCCAATATCATCCAGAAGCCGGAAGGTAGCGGCAATGCGAAGACCCCACCGAAGAAGGACTTGCTGAGCGAGCCA
ATGGCTGGAAAGAAAGAACAAAGAAAGGCTGACTGGGCTATTATGAAAGAAATGGCCAAGTATCTGTGGCCAAAG
GATGATTGGGGCACGAAGCTCCGTGTCGGCACAGCACTTTCACTGCTTATTGGTGCAAAGATCCTCAATGTGGAA
ATCCCCTTCTACTTCAAGAACATTGTCGACTCCATGAATATAGACTTTGCTACCGTCGGTGGAACTGCCTATACC
GTGGCTGGGTCAATGATTATTGCATACGGTGTGACCCGAATCGGAGCTACATTGTTTCAAGAGCTCCGTAATGCG
GTCTTTGCTAGCGTTGCGCAAAAGGCAATTCGGAAGGTGGCGTCAAATGTTTTTGAACATCTGTTGCGACTGGAT
CTCAACTTCCACCTGTCTCGGCAGACCGGAGGTCTGACTCGTGCAATTGACCGCGGTACTAAGGGCATCAGCTTC
CTCCTTACCTCCATGGTTTTCCACGTAGTACCAACAGCACTTGAGATTTCCCTTGTCTGCGGTATCTTGACTTAT
CAATATGGCCTCCAATTTGCTGCGATCACAACAACAACAATGATAGCTTATACGGTGTTCACCATCACTACAACC
GCGTGGCGAACAAAATTCCGGAGACAAGCCAATGCGGCTGATAACCGCGGAGCAACCGTTGCTGTGGACTCGCTC
ATCAACTATGAGGCCGTTAAGTACTTCAATAACGAGAAATTCGAAGTGGCACGATACGACAAAGCCCTGAAGAAG
TATGAAGATGCATCAATCAAGGTGACTACATCTCTGGCATTCCTCAACTCTGGTCAAAACATGATCTTCTCCTCT
GCGCTGGCCGCAATGATGTACCTGGCTTGCAATGGAGTTGCGAACGGAACCATGACCGTCGGTGACCTAGTCATG
GTCAACCAGCTGGTCTTCCAGCTCTCAGTCCCCCTCAACTTCTTGGGGTCTGTCTATCGTGAGCTGCGCCAGTCC
CTGCTGGACATGGAGACGCTTTTCAACCTGCAGAAGGTGAACGTCACCATCAAGGAACGGCCCAACGCCAAGCCG
CTGCAGCTGACGCAGGGCGGCCAGATCCGCTTTGAGAACGTCACGTTTGGCTACCACCCAGAGCGACCGATTCTG
AAGAATGCCACCTTCACTATCCCCGCAGGACAGAAGTTTGCCATTGTCGGCCCTAGCGGCTGCGGCAAGTCTACG
ATCTTACGTCTGCTTTTCCGTTTCTATGACGTCCAGTCCGGTCGTATCTTGATTGACGGCCAAGATATCCGCGAT
GTGACCGTCGACAGCCTTCGCAAGGCAATTGGAGTGGTACCGCAGGACACACCTCTGTTCAATGACACTATCGCC
CATAACATCCGCTATGGACGGATTGATGCGTCGGACGAAGAAGTGCGCCGAGCTGCGGAACGAGCCCACATCCAC
AAGCTTATTGAGGGTCTGCCTGATGGCTACCAAACTGCGGTTGGTGAGCGTGGTATGATGATCTCCGGAGGTGAG
AAGCAGCGGCTAGCAATTTCTCGGTTGATCCTGAAGGACCCGAAACTCTTCTTCTTCGATGAGGCAACATCCGCC
CTAGATACCTACACGGAGCAGGCGCTCCTCCAGAATATCAACAGCATTCTCAAAGAGAAGAGCCGCACAAGCGTG
TTTGTGGCTCATCGCCTACGCACTATCTCCGACAGTGACCAGATTTTGGTCTTGAAGGAAGGTCATGTGGCAGAG
ATGGGCTCACACCGCGAGTTGCTCGAGCATGACGGCACCTATGCAGAGCTTTGGAATACCCAGGAACAGACAATG
GCTCATGATGGGAGCCTGGAGCAGAGTCAGGTTGAGGATGTTCAGCCCAAGGCGTGA
Transcript >Pro_DTO377G3_2|g5302.t1
ATGCTGCTCAGAGCCGCACGATCGCCGTGCTGGCGCACAGCACAATTCACCTATCCGAGCTTCGCCGGCAAGCCA
CGAAGCACACGACTCAATGGAACACACCTGCGCGCATTCACATCAAATAAGAGTTCATTATGGAGTCAATCCACA
GACACAGACAAGAAAGATCACGCATCTGTCAAAGCTACTCCTACCTCTACTCCCGCCTCATCACAACTAGCAGAC
GCCAATATCATCCAGAAGCCGGAAGGTAGCGGCAATGCGAAGACCCCACCGAAGAAGGACTTGCTGAGCGAGCCA
ATGGCTGGAAAGAAAGAACAAAGAAAGGCTGACTGGGCTATTATGAAAGAAATGGCCAAGTATCTGTGGCCAAAG
GATGATTGGGGCACGAAGCTCCGTGTCGGCACAGCACTTTCACTGCTTATTGGTGCAAAGATCCTCAATGTGGAA
ATCCCCTTCTACTTCAAGAACATTGTCGACTCCATGAATATAGACTTTGCTACCGTCGGTGGAACTGCCTATACC
GTGGCTGGGTCAATGATTATTGCATACGGTGTGACCCGAATCGGAGCTACATTGTTTCAAGAGCTCCGTAATGCG
GTCTTTGCTAGCGTTGCGCAAAAGGCAATTCGGAAGGTGGCGTCAAATGTTTTTGAACATCTGTTGCGACTGGAT
CTCAACTTCCACCTGTCTCGGCAGACCGGAGGTCTGACTCGTGCAATTGACCGCGGTACTAAGGGCATCAGCTTC
CTCCTTACCTCCATGGTTTTCCACGTAGTACCAACAGCACTTGAGATTTCCCTTGTCTGCGGTATCTTGACTTAT
CAATATGGCCTCCAATTTGCTGCGATCACAACAACAACAATGATAGCTTATACGGTGTTCACCATCACTACAACC
GCGTGGCGAACAAAATTCCGGAGACAAGCCAATGCGGCTGATAACCGCGGAGCAACCGTTGCTGTGGACTCGCTC
ATCAACTATGAGGCCGTTAAGTACTTCAATAACGAGAAATTCGAAGTGGCACGATACGACAAAGCCCTGAAGAAG
TATGAAGATGCATCAATCAAGGTGACTACATCTCTGGCATTCCTCAACTCTGGTCAAAACATGATCTTCTCCTCT
GCGCTGGCCGCAATGATGTACCTGGCTTGCAATGGAGTTGCGAACGGAACCATGACCGTCGGTGACCTAGTCATG
GTCAACCAGCTGGTCTTCCAGCTCTCAGTCCCCCTCAACTTCTTGGGGTCTGTCTATCGTGAGCTGCGCCAGTCC
CTGCTGGACATGGAGACGCTTTTCAACCTGCAGAAGGTGAACGTCACCATCAAGGAACGGCCCAACGCCAAGCCG
CTGCAGCTGACGCAGGGCGGCCAGATCCGCTTTGAGAACGTCACGTTTGGCTACCACCCAGAGCGACCGATTCTG
AAGAATGCCACCTTCACTATCCCCGCAGGACAGAAGTTTGCCATTGTCGGCCCTAGCGGCTGCGGCAAGTCTACG
ATCTTACGTCTGCTTTTCCGTTTCTATGACGTCCAGTCCGGTCGTATCTTGATTGACGGCCAAGATATCCGCGAT
GTGACCGTCGACAGCCTTCGCAAGGCAATTGGAGTGGTACCGCAGGACACACCTCTGTTCAATGACACTATCGCC
CATAACATCCGCTATGGACGGATTGATGCGTCGGACGAAGAAGTGCGCCGAGCTGCGGAACGAGCCCACATCCAC
AAGCTTATTGAGGGTCTGCCTGATGGCTACCAAACTGCGGTTGGTGAGCGTGGTATGATGATCTCCGGAGGTGAG
AAGCAGCGGCTAGCAATTTCTCGGTTGATCCTGAAGGACCCGAAACTCTTCTTCTTCGATGAGGCAACATCCGCC
CTAGATACCTACACGGAGCAGGCGCTCCTCCAGAATATCAACAGCATTCTCAAAGAGAAGAGCCGCACAAGCGTG
TTTGTGGCTCATCGCCTACGCACTATCTCCGACAGTGACCAGATTTTGGTCTTGAAGGAAGGTCATGTGGCAGAG
ATGGGCTCACACCGCGAGTTGCTCGAGCATGACGGCACCTATGCAGAGCTTTGGAATACCCAGGAACAGACAATG
GCTCATGATGGGAGCCTGGAGCAGAGTCAGGTTGAGGATGTTCAGCCCAAGGCGTGA
Gene >Pro_DTO377G3_2|g5302.t1
ATGCTGCTCAGAGCCGCACGATCGCCGTGCTGGCGCACAGCACAATTCACCTATCCGAGCTTCGCCGGCAAGCCA
CGAAGCACACGACTCAATGGAACACACCTGCGCGCATTCACATCAAATAAGAGTTCATTATGGAGTCAATCCACA
GACACAGACAAGAAAGATCACGCATCTGTCAAAGCTACTCCTACCTCTACTCCCGCCTCATCACAACTAGCAGAC
GCCAATATCATCCAGAAGCCGGAAGGTAGCGGCAATGCGAAGACCCCACCGAAGAAGGACTTGCTGAGCGAGCCA
ATGGCTGGAAAGAAAGAACAAAGAAAGGCTGACTGGGCTATTATGAAAGAAATGGCCAAGTATCTGTGGCCAAAG
GTAAGCCTCGAGTGCAATTGGTATGGAGTAACAGGGTATTAACTATAGCTGGTAGGATGATTGGGGCACGAAGCT
CCGTGTCGGCACAGCACTTTCACTGCTTATTGGTGCAAAGGCAAGTTTCGTCTGTTATTGTGTTTTCGTTAAAAT
ATGCTTATATGAATCCAATAGATCCTCAATGTGGAAATCCCCTTCTACTTCAAGAACATTGTCGACTCCATGAAT
ATAGACTTTGCTACCGTCGGTGGAACTGCCTATACCGTGGCTGGGTCAATGATTATTGCATGTAAGGATAACAGC
ATATCGAAGAGAGACTTGTCGCTAATATGTCTTAGACGGTGTGACCCGAATCGGAGCTACATTGTTTCAAGAGCT
CCGTAATGCGGTCTTTGCTAGCGTTGCGCAAAAGGCAATTCGGAAGGTGGCGTCAAATGTTTTTGAACATCTGTT
GCGACTGGATCTCAACTTCCACCTGTCTCGGCAGACCGGAGGTCTGACTCGTGCAATTGACCGCGGTACTAAGGG
CATCAGCTTCCTCCTTACCTCCATGGTTTTCCACGTAGTACCAACAGCACTTGAGATTTCCCTTGTCTGCGGTAT
CTTGGTATGATTTGGAACCTATATTTACGTTTCTATCTTACTAACGCGTTGTAGACTTATCAATATGGCCTCCAA
TTTGCTGCGATCACAACAACAACAATGATAGCTTATACGGTGTTCACCATCACTACAACCGCGTGGCGAACAAAA
TTCCGGAGACAAGCCAATGCGGCTGATAACCGCGGAGCAACCGTTGCTGTGGACTCGCTCATCAACTATGAGGCC
GTTAAGTACTTCAATAACGAGAAATTCGAAGTGGCACGATACGACAAAGCCCTGAAGAAGTATGAAGATGCATCA
ATCAAGGTGACTACATCTCTGGCATTCCTCAACTCTGGTCAAAACATGATCTTCTCCTCTGCGCTGGCCGCAATG
ATGTACCTGGCTTGCAATGGAGTTGCGAACGGAACCATGACCGTCGGTGACCTAGTCATGGTCAACCAGCTGGTC
TTCCAGCTCTCAGTCCCCCTCAACTTCTTGGGGTCTGTCTATCGTGAGCTGCGCCAGTCCCTGCTGGACATGGAG
ACGCTTTTCAACCTGCAGAAGGTGAACGTCACCATCAAGGAACGGCCCAACGCCAAGCCGCTGCAGCTGACGCAG
GGCGGCCAGATCCGCTTTGAGAACGTCACGTTTGGCTACCACCCAGAGCGACCGATTCTGAAGAATGCCACCTTC
ACTATCCCCGCAGGACAGAAGTTTGCCATTGTCGGCCCTAGCGGCTGCGGCAAGTCTACGATCTTACGTCTGCTT
TTCCGTTTCTATGACGTCCAGTCCGGTCGTATCTTGATTGACGGCCAAGATATCCGCGATGTGACCGTCGACAGC
CTTCGCAAGGCAATTGGAGTGGTACCGCAGGACACACCTCTGTTCAATGACACTATCGCCCATAACATCCGCTAT
GGACGGATTGATGCGTCGGACGAAGAAGTGCGCCGAGCTGCGGAACGAGCCCACATCCACAAGCTTATTGAGGGT
CTGCCTGATGGCTACCAAACTGCGGTTGGTGAGCGTGGTATGATGATCTCCGGAGGTGAGAAGCAGCGGCTAGCA
ATTTCTCGGTTGATCCTGAAGGACCCGAAACTCTTCTTCTTCGATGAGGCAGTAAGTGATCATTCCTTGGTCCCA
CTTGATTGAGATAACTAATCACCCTCTCTATAGACATCCGCCCTAGATACCTACACGGAGCAGGCGCTCCTCCAG
AATATCAACAGCATTCTCAAAGAGAAGAGCCGCACAAGCGTGTTTGTGGCTCATCGCCTACGCACTATCTCCGAC
AGTGACCAGATTTTGGTCTTGAAGGAAGGTCATGTGGCAGAGATGGGCTCACACCGCGAGTTGCTCGAGCATGAC
GGCACCTATGCAGAGCTTTGGAATAGTAAGTCCTCTTTTCTTTGCTGTTAATACTCCTTACTAACTCAATTTCAG
CCCAGGAACAGACAATGGCTCATGATGGGAGCCTGGAGCAGAGTCAGGTTGAGGATGTTCAGCCCAAGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail