Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5298.t1
Gene name
Locationscaffold_12:421242..423614
Strand+
Gene length (bp)2372
Transcript length (bp)2253
Coding sequence length (bp)2253
Protein length (aa) 751

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00225 Kinesin Kinesin motor domain 9.9E-81 8 356
PF16796 Microtub_bd Microtubule binding 9.9E-20 3 176

GO

GO Term Description Terminal node
GO:0008017 microtubule binding Yes
GO:0003777 microtubule motor activity Yes
GO:0005524 ATP binding Yes
GO:0007018 microtubule-based movement Yes
GO:0005488 binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0140657 ATP-dependent activity No
GO:0030554 adenyl nucleotide binding No
GO:0015631 tubulin binding No
GO:0007017 microtubule-based process No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0005515 protein binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0008092 cytoskeletal protein binding No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0009987 cellular process No
GO:0003774 cytoskeletal motor activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 28.71 16.77 40.66
5d_25C Five days - 25 degrees Celsius 16.23 8.43 24.03
7d_25C Seven days - 25 degrees Celsius 13.99 6.88 21.10
10d_25C Ten days - 25 degrees Celsius 8.55 3.73 13.36
7d_15C Seven days - 15 degrees Celsius 15.66 6.82 24.50
7d_30C Seven days - 30 degrees Celsius 18.38 9.71 27.05

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.016924 yes
3d_25C 7d_25C 0.003197 yes
3d_25C 7d_15C 0.025371 yes
3d_25C 7d_30C 0.079412 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.671102 no
5d_25C 7d_15C 0.937078 no
5d_25C 7d_30C 0.731910 no
5d_25C 10d_25C 0.022940 yes
7d_25C 7d_15C 0.779532 no
7d_25C 7d_30C 0.370149 no
7d_25C 10d_25C 0.092657 no
7d_15C 7d_30C 0.669678 no
7d_15C 10d_25C 0.044995 yes
7d_30C 10d_25C 0.006742 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5298.t1
MSVRVVARIRPLLKSEREADVIVRTGSSAITDKSRQSINGDKSDKSDKKLAALRDRDNVVRIPNPKNEGEEYAFQ
FNGVYGAEVSQQELFDAEVSPTIKHLLNGFDVTLFAYGVTGTGKTHTMRGGKTLADRGVIPRLLSGIYRRSRKIE
KDSEGETTVQVALSYYEIYNDKVYDLFEPPEKRTMSGLPLRDNGGKTVVCGLSEKPCTTLKEFEQLYDQANTNRS
TSATKLNAHSSRSHAVLGVKVTISSPDKVRVSTASAIDLAGSEDNRRTENDKERMVESASINKSLFVLAQCVEAI
NKKQHRIPYRESKMTRILSLGQNNGLTVMILNLAPVRSYHLDTISSLNVANRTRKIEVREVENDPMFKGPARPSI
RPSMGTRQPLRALTASVNVNMPAPAAKDTAEKEEGKPVKAFSVYSDKPQPKLISQIRKLEAPKRTSISNAPSGLP
SLKPARQPLGVQPTARHDDFSAARIEEMVERKVEEILAVRAVSEQSRQTQVHELNEQLQKRLEQLEQRIDGTEDA
RAEGLSYLLMAKQHQAHGEDGSALRMYQLAAPHFPHNEKLAAKIAALQERVHAKAWEEKPDSPPKGRLGSMLSLK
KDVTQTLGKRQAETHEDSYIDQTHAGFSSGEDVLRQKHKKRAAAKLGQVEEAPELLDSEDPSLSPRTKHILSIIN
SRDVSRIRLLKGVGAKKAEALVDCLCEMDQPTVDTTDSGVVSDQLQFQVTSLAQLSQLKGVGVKTVQNMRQGVLA
*
Coding >Pro_DTO377G3_2|g5298.t1
ATGAGTGTCCGAGTTGTCGCGCGTATCCGTCCCCTTCTCAAGTCCGAACGGGAGGCCGATGTGATCGTTCGTACA
GGATCTTCCGCCATCACCGATAAATCACGCCAGTCAATCAATGGCGACAAGAGTGACAAGAGTGACAAGAAATTG
GCAGCATTGAGGGACAGAGATAATGTGGTTCGAATTCCGAACCCCAAGAATGAGGGGGAGGAGTATGCGTTCCAG
TTCAATGGCGTGTACGGCGCAGAGGTATCGCAGCAGGAGCTGTTCGATGCTGAGGTGTCCCCAACAATTAAGCAT
CTTCTCAACGGATTCGACGTGACCCTTTTCGCATACGGTGTCACCGGAACAGGCAAAACACACACAATGCGGGGC
GGGAAAACACTGGCTGACCGGGGTGTAATCCCGCGGCTGCTCAGTGGAATCTACCGACGTAGCCGGAAGATTGAA
AAGGACAGCGAGGGAGAGACGACAGTCCAGGTCGCCCTGAGTTATTATGAAATCTACAATGACAAGGTGTACGAC
TTGTTTGAGCCGCCCGAGAAGCGCACAATGTCAGGTCTTCCCCTGCGGGATAATGGTGGCAAGACTGTGGTTTGC
GGGCTGAGCGAGAAGCCGTGTACCACTTTGAAGGAGTTTGAGCAGCTTTATGACCAGGCTAACACTAACCGTTCC
ACCTCCGCGACAAAGCTCAACGCCCATTCATCTCGATCTCACGCCGTTCTCGGTGTGAAGGTCACCATCTCCTCT
CCTGACAAGGTTCGCGTCAGCACTGCTTCCGCTATTGATCTCGCGGGATCCGAAGACAATAGACGGACGGAAAAT
GACAAAGAGCGCATGGTGGAATCGGCTAGCATCAACAAGAGTCTTTTCGTTCTGGCACAGTGTGTCGAGGCTATC
AACAAGAAGCAGCACCGCATCCCGTACCGCGAGTCCAAGATGACAAGAATTTTGTCCTTGGGACAGAACAATGGA
TTGACAGTGATGATTCTCAACCTTGCGCCTGTCCGGTCTTACCACCTTGACACAATTAGCTCTCTAAACGTCGCC
AATCGCACACGGAAGATCGAGGTCCGAGAGGTCGAAAATGATCCCATGTTCAAGGGTCCGGCCCGGCCATCTATT
CGGCCATCTATGGGTACGCGGCAACCTCTACGTGCACTGACTGCTTCTGTGAATGTAAATATGCCGGCGCCTGCT
GCGAAGGACACCGCAGAAAAGGAAGAGGGCAAACCCGTTAAGGCATTCAGCGTATACTCGGACAAGCCCCAACCC
AAGCTTATCAGCCAGATCCGAAAACTGGAAGCACCGAAACGCACCTCAATCTCCAATGCCCCCTCCGGCCTTCCG
TCATTGAAGCCCGCCCGTCAGCCCCTGGGTGTGCAACCCACCGCGCGTCATGATGACTTCTCGGCTGCTAGGATT
GAGGAGATGGTTGAGAGGAAGGTTGAGGAGATCTTAGCTGTGCGGGCTGTGAGCGAACAATCGCGGCAGACACAA
GTCCATGAGCTTAATGAGCAGCTTCAAAAGCGATTGGAGCAGTTGGAGCAGCGCATTGATGGCACAGAAGATGCA
CGGGCTGAGGGTCTGTCATACCTGCTGATGGCTAAACAACATCAGGCACATGGTGAAGACGGGTCAGCCCTGAGA
ATGTACCAGCTGGCAGCTCCTCACTTCCCTCACAACGAGAAGCTGGCAGCCAAGATTGCTGCCTTGCAGGAACGG
GTTCATGCAAAGGCTTGGGAAGAGAAACCCGATTCCCCGCCCAAGGGGAGGCTGGGTAGCATGCTCTCCCTTAAG
AAGGACGTAACACAAACCCTCGGCAAACGCCAAGCAGAGACTCATGAGGATAGCTATATAGACCAGACTCATGCC
GGTTTCTCGAGTGGCGAGGATGTTCTTCGCCAAAAACATAAGAAGCGTGCTGCAGCCAAGCTCGGCCAGGTCGAG
GAAGCCCCCGAACTCCTTGACAGTGAGGACCCATCCCTCTCTCCCCGAACTAAGCATATTCTTTCCATCATCAAC
TCGCGGGACGTGAGCCGGATCAGATTGCTCAAGGGAGTGGGTGCCAAAAAGGCAGAGGCTCTTGTTGATTGCCTC
TGCGAGATGGACCAGCCTACAGTGGATACAACCGACAGCGGAGTCGTCTCAGACCAGCTCCAATTCCAGGTCACC
AGCCTGGCACAACTGAGCCAGCTGAAAGGCGTTGGGGTCAAGACGGTTCAGAACATGAGACAAGGGGTATTGGCT
TAA
Transcript >Pro_DTO377G3_2|g5298.t1
ATGAGTGTCCGAGTTGTCGCGCGTATCCGTCCCCTTCTCAAGTCCGAACGGGAGGCCGATGTGATCGTTCGTACA
GGATCTTCCGCCATCACCGATAAATCACGCCAGTCAATCAATGGCGACAAGAGTGACAAGAGTGACAAGAAATTG
GCAGCATTGAGGGACAGAGATAATGTGGTTCGAATTCCGAACCCCAAGAATGAGGGGGAGGAGTATGCGTTCCAG
TTCAATGGCGTGTACGGCGCAGAGGTATCGCAGCAGGAGCTGTTCGATGCTGAGGTGTCCCCAACAATTAAGCAT
CTTCTCAACGGATTCGACGTGACCCTTTTCGCATACGGTGTCACCGGAACAGGCAAAACACACACAATGCGGGGC
GGGAAAACACTGGCTGACCGGGGTGTAATCCCGCGGCTGCTCAGTGGAATCTACCGACGTAGCCGGAAGATTGAA
AAGGACAGCGAGGGAGAGACGACAGTCCAGGTCGCCCTGAGTTATTATGAAATCTACAATGACAAGGTGTACGAC
TTGTTTGAGCCGCCCGAGAAGCGCACAATGTCAGGTCTTCCCCTGCGGGATAATGGTGGCAAGACTGTGGTTTGC
GGGCTGAGCGAGAAGCCGTGTACCACTTTGAAGGAGTTTGAGCAGCTTTATGACCAGGCTAACACTAACCGTTCC
ACCTCCGCGACAAAGCTCAACGCCCATTCATCTCGATCTCACGCCGTTCTCGGTGTGAAGGTCACCATCTCCTCT
CCTGACAAGGTTCGCGTCAGCACTGCTTCCGCTATTGATCTCGCGGGATCCGAAGACAATAGACGGACGGAAAAT
GACAAAGAGCGCATGGTGGAATCGGCTAGCATCAACAAGAGTCTTTTCGTTCTGGCACAGTGTGTCGAGGCTATC
AACAAGAAGCAGCACCGCATCCCGTACCGCGAGTCCAAGATGACAAGAATTTTGTCCTTGGGACAGAACAATGGA
TTGACAGTGATGATTCTCAACCTTGCGCCTGTCCGGTCTTACCACCTTGACACAATTAGCTCTCTAAACGTCGCC
AATCGCACACGGAAGATCGAGGTCCGAGAGGTCGAAAATGATCCCATGTTCAAGGGTCCGGCCCGGCCATCTATT
CGGCCATCTATGGGTACGCGGCAACCTCTACGTGCACTGACTGCTTCTGTGAATGTAAATATGCCGGCGCCTGCT
GCGAAGGACACCGCAGAAAAGGAAGAGGGCAAACCCGTTAAGGCATTCAGCGTATACTCGGACAAGCCCCAACCC
AAGCTTATCAGCCAGATCCGAAAACTGGAAGCACCGAAACGCACCTCAATCTCCAATGCCCCCTCCGGCCTTCCG
TCATTGAAGCCCGCCCGTCAGCCCCTGGGTGTGCAACCCACCGCGCGTCATGATGACTTCTCGGCTGCTAGGATT
GAGGAGATGGTTGAGAGGAAGGTTGAGGAGATCTTAGCTGTGCGGGCTGTGAGCGAACAATCGCGGCAGACACAA
GTCCATGAGCTTAATGAGCAGCTTCAAAAGCGATTGGAGCAGTTGGAGCAGCGCATTGATGGCACAGAAGATGCA
CGGGCTGAGGGTCTGTCATACCTGCTGATGGCTAAACAACATCAGGCACATGGTGAAGACGGGTCAGCCCTGAGA
ATGTACCAGCTGGCAGCTCCTCACTTCCCTCACAACGAGAAGCTGGCAGCCAAGATTGCTGCCTTGCAGGAACGG
GTTCATGCAAAGGCTTGGGAAGAGAAACCCGATTCCCCGCCCAAGGGGAGGCTGGGTAGCATGCTCTCCCTTAAG
AAGGACGTAACACAAACCCTCGGCAAACGCCAAGCAGAGACTCATGAGGATAGCTATATAGACCAGACTCATGCC
GGTTTCTCGAGTGGCGAGGATGTTCTTCGCCAAAAACATAAGAAGCGTGCTGCAGCCAAGCTCGGCCAGGTCGAG
GAAGCCCCCGAACTCCTTGACAGTGAGGACCCATCCCTCTCTCCCCGAACTAAGCATATTCTTTCCATCATCAAC
TCGCGGGACGTGAGCCGGATCAGATTGCTCAAGGGAGTGGGTGCCAAAAAGGCAGAGGCTCTTGTTGATTGCCTC
TGCGAGATGGACCAGCCTACAGTGGATACAACCGACAGCGGAGTCGTCTCAGACCAGCTCCAATTCCAGGTCACC
AGCCTGGCACAACTGAGCCAGCTGAAAGGCGTTGGGGTCAAGACGGTTCAGAACATGAGACAAGGGGTATTGGCT
TAA
Gene >Pro_DTO377G3_2|g5298.t1
ATGAGTGTCCGAGTTGTCGCGCGTATCCGTCCCCTTCTCAAGTCCGAACGGGAGGCCGATGTGATCGTTCGTACA
GGATCTTCCGCCATCACCGATAAATCACGCCAGTCAATCAATGGCGACAAGAGTGACAAGAGTGACAAGAAATTG
GCAGCATTGAGGGACAGAGATAATGTGGTTCGAATTCCGAACCCCAAGAATGAGGGGGAGGAGTATGCGTTCCAG
TTCAATGGCGTGTACGGCGCAGAGGTATCGCAGCAGGAGCTGTTCGATGCTGAGGGTAAGTTCTTGTTTTAAGCT
CATCTGGTCTGCGATGGGTCAGTATATTGATCCGGTTCACAGTGTCCCCAACAATTAAGCATCTTCTCAACGGAT
TCGACGTGACCCTTTTCGCATACGGTGTCACCGGAACAGGCAAAACACACACAATGCGGGGCGGGAAAACACTGG
CTGACCGGGGTGTAATCCCGCGGCTGCTCAGTGGAATCTACCGACGTAGCCGGAAGATTGAAAAGGACAGCGAGG
GAGAGACGACAGTCCAGGTCGCCCTGAGTTATTATGAAATCTACAATGACAAGGTGTACGACTTGTTTGAGCCGC
CCGAGAAGCGCACAATGTCAGGTCTTCCCCTGCGGGATAATGGTGGCAAGACTGTGGTTTGCGGGCTGAGCGAGA
AGCCGTGTACCACTTTGAAGGAGTTTGAGCAGCTTTATGACCAGGCTAACACTAACCGTTCCACCTCCGCGACAA
AGGTATGATACCACGCCGAAAGCTAGGGCCCATATTCTCTCGCTAAACATACAACATAGCTCAACGCCCATTCAT
CTCGATCTCACGCCGTTCTCGGTGTGAAGGTCACCATCTCCTCTCCTGACAAGGTTCGCGTCAGCACTGCTTCCG
CTATTGATCTCGCGGGATCCGAAGACAATAGACGGACGGAAAATGACAAAGAGCGCATGGTGGAATCGGCTAGCA
TCAACAAGAGTCTTTTCGTTCTGGCACAGTGTGTCGAGGCTATCAACAAGAAGCAGCACCGCATCCCGTACCGCG
AGTCCAAGATGACAAGAATTTTGTCCTTGGGACAGAACAATGGATTGACAGTGATGATTCTCAACCTTGCGCCTG
TCCGGTCTTACCACCTTGACACAATTAGCTCTCTAAACGTCGCCAATCGCACACGGAAGATCGAGGTCCGAGAGG
TCGAAAATGATCCCATGTTCAAGGGTCCGGCCCGGCCATCTATTCGGCCATCTATGGGTACGCGGCAACCTCTAC
GTGCACTGACTGCTTCTGTGAATGTAAATATGCCGGCGCCTGCTGCGAAGGACACCGCAGAAAAGGAAGAGGGCA
AACCCGTTAAGGCATTCAGCGTATACTCGGACAAGCCCCAACCCAAGCTTATCAGCCAGATCCGAAAACTGGAAG
CACCGAAACGCACCTCAATCTCCAATGCCCCCTCCGGCCTTCCGTCATTGAAGCCCGCCCGTCAGCCCCTGGGTG
TGCAACCCACCGCGCGTCATGATGACTTCTCGGCTGCTAGGATTGAGGAGATGGTTGAGAGGAAGGTTGAGGAGA
TCTTAGCTGTGCGGGCTGTGAGCGAACAATCGCGGCAGACACAAGTCCATGAGCTTAATGAGCAGCTTCAAAAGC
GATTGGAGCAGTTGGAGCAGCGCATTGATGGCACAGAAGATGCACGGGCTGAGGGTCTGTCATACCTGCTGATGG
CTAAACAACATCAGGCACATGGTGAAGACGGGTCAGCCCTGAGAATGTACCAGCTGGCAGCTCCTCACTTCCCTC
ACAACGAGAAGCTGGCAGCCAAGATTGCTGCCTTGCAGGAACGGGTTCATGCAAAGGCTTGGGAAGAGAAACCCG
ATTCCCCGCCCAAGGGGAGGCTGGGTAGCATGCTCTCCCTTAAGAAGGACGTAACACAAACCCTCGGCAAACGCC
AAGCAGAGACTCATGAGGATAGCTATATAGACCAGACTCATGCCGGTTTCTCGAGTGGCGAGGATGTTCTTCGCC
AAAAACATAAGAAGCGTGCTGCAGCCAAGCTCGGCCAGGTCGAGGAAGCCCCCGAACTCCTTGACAGTGAGGACC
CATCCCTCTCTCCCCGAACTAAGCATATTCTTTCCATCATCAACTCGCGGGACGTGAGCCGGATCAGATTGCTCA
AGGGAGTGGGTGCCAAAAAGGCAGAGGCTCTTGTTGATTGCCTCTGCGAGATGGACCAGCCTACAGTGGATACAA
CCGACAGCGGAGTCGTCTCAGACCAGCTCCAATTCCAGGTCACCAGCCTGGCACAACTGAGCCAGCTGAAAGGCG
TTGGGGTCAAGACGGTTCAGAACATGAGACAAGGGGTATTGGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail