Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5283.t1
Gene name
Locationscaffold_12:383364..385468
Strand-
Gene length (bp)2104
Transcript length (bp)1875
Coding sequence length (bp)1875
Protein length (aa) 625

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04114 Gaa1 Gaa1-like, GPI transamidase component 9.3E-189 133 616

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0042765 GPI-anchor transamidase complex Yes
GO:1902494 catalytic complex No
GO:1905369 endopeptidase complex No
GO:1905368 peptidase complex No
GO:0032991 protein-containing complex No
GO:0098796 membrane protein complex No
GO:0008303 caspase complex No
GO:0110165 cellular anatomical entity No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 21 40 19
2 373 395 22
3 435 457 22
4 467 489 22
5 510 532 22
6 558 580 22
7 601 623 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5283.t1
MALKSAIRNLRNNPNLLYVRLPNLVSFICIVVGVVWLLLLPLNEYSRQTYISENALLPGQVHAYFTGSEQNIFRG
YKKELEGLLNDGQARGGQKDEAEVTAALSDKLQSILQAAGLKVATQKYEYTSAGITHQGENTYAIIHAPRGDATE
AIVLVAPWKTADDELNLNGVTLALTLARYFKRWSLWSKDIIFLIPPDSKTGTQAWIDAYHDMHPASVQPLPLKSG
ALQGALVIEYPFEHRFQTLHIVYDGVNGQLPNLDLFNTAVAIAGGQMGIGANLQEMWGHDDSYEHRLQTMFRGMT
KQGLGYATGAHSSFMPYHIDAITLQTKGEGWEDEMALGRTIESLCRSLNNLLEHLHQSFFFYLLMQSNRFVSIGT
YLPSAMLIAGNFTIMAIALWIRTGYYPESKPSAKPKNEKAPTEEKGTNTIVERNTIAERYLALPLSLVVGLHLLG
LVPLWVFNNVFHQYFTTTTYIFVVVDIILPLLLAAILSNGLGVSKPIIPQQYHLIKSFSLLLLGLSLSTLATLNF
SLSFMIGLLCAPLSFIPRLRGSVPFRLATSSLGLVLLNLVSPPAVLLGVCWYMGVSVETVLTQAAFGWDVWGMWT
QVVVWCVWWPAWLIGCVLLGSSIF*
Coding >Pro_DTO377G3_2|g5283.t1
ATGGCATTGAAATCTGCAATCCGCAACTTGCGGAATAACCCCAATCTCCTCTATGTTCGCCTCCCGAATCTCGTA
TCCTTCATCTGCATAGTCGTCGGTGTCGTCTGGCTACTTCTCCTCCCTCTAAACGAGTATTCCCGACAGACCTAC
ATCTCCGAGAATGCGCTCTTGCCGGGCCAAGTCCATGCGTATTTCACGGGAAGCGAGCAGAACATCTTCCGGGGT
TACAAGAAAGAATTGGAAGGATTGTTGAATGATGGACAGGCGAGAGGCGGCCAAAAAGACGAGGCGGAAGTGACA
GCGGCGCTCTCGGACAAGTTGCAGTCAATCTTGCAAGCGGCGGGCCTTAAAGTTGCCACGCAAAAATACGAATAC
ACCTCCGCTGGGATTACGCACCAGGGCGAGAATACTTATGCCATTATCCATGCGCCGCGCGGTGATGCCACGGAG
GCGATTGTGCTGGTTGCGCCGTGGAAGACGGCTGATGATGAGCTGAACCTGAATGGTGTCACTCTTGCCTTGACA
TTGGCAAGATACTTCAAGAGATGGTCGTTATGGTCCAAGGATATCATCTTCTTAATTCCTCCGGACAGTAAAACT
GGCACTCAGGCTTGGATCGATGCCTACCACGATATGCACCCGGCTTCGGTGCAGCCACTTCCTTTGAAGAGTGGA
GCATTGCAAGGTGCACTAGTCATCGAATACCCATTCGAGCACCGGTTCCAGACCCTCCATATTGTATATGACGGA
GTCAATGGCCAACTCCCTAACCTCGACCTGTTCAATACAGCTGTAGCCATTGCAGGCGGCCAGATGGGCATCGGG
GCCAATCTACAGGAAATGTGGGGTCACGACGACAGCTACGAGCATCGTCTGCAGACTATGTTCCGCGGTATGACC
AAGCAGGGTCTCGGGTATGCCACCGGCGCACACAGCAGCTTCATGCCGTACCATATCGACGCTATCACACTGCAG
ACCAAGGGCGAGGGATGGGAGGATGAGATGGCCCTGGGCCGGACGATTGAGTCTCTTTGTCGCAGCTTGAACAAC
TTGCTAGAGCACCTGCACCAGAGCTTTTTCTTCTACCTGCTCATGCAGTCCAACCGTTTTGTCAGCATTGGAACC
TACTTGCCCAGCGCGATGTTGATCGCTGGAAACTTCACCATCATGGCAATTGCTCTCTGGATACGTACTGGGTAC
TATCCGGAAAGCAAGCCAAGTGCTAAACCAAAGAATGAGAAGGCACCCACCGAAGAGAAGGGGACGAATACTATT
GTCGAAAGGAATACTATCGCAGAACGATACCTTGCTTTACCACTCTCGCTTGTTGTCGGACTCCATCTACTCGGC
CTTGTCCCGCTCTGGGTCTTTAATAATGTCTTCCATCAGTACTTCACAACTACCACCTACATATTTGTGGTCGTG
GACATCATCCTACCCCTTCTCCTTGCCGCAATTCTCTCCAACGGCCTCGGTGTATCAAAACCAATCATCCCCCAA
CAGTACCACCTCATAAAATCCTTCTCCCTCCTCCTACTGGGTCTCTCCCTCTCAACCCTCGCCACCCTCAACTTC
TCCCTTTCATTCATGATTGGTCTGCTCTGCGCGCCACTTAGCTTCATCCCTCGCCTGCGAGGCTCCGTGCCATTC
CGCTTGGCAACCTCCAGTCTGGGTCTGGTGCTTCTCAACCTCGTCTCCCCGCCAGCTGTTCTCCTTGGCGTCTGC
TGGTATATGGGGGTCTCAGTCGAGACTGTCCTCACCCAGGCGGCTTTCGGTTGGGATGTTTGGGGTATGTGGACC
CAGGTCGTTGTTTGGTGTGTGTGGTGGCCGGCTTGGTTGATTGGCTGCGTGTTGCTGGGGTCGTCGATTTTCTGA
Transcript >Pro_DTO377G3_2|g5283.t1
ATGGCATTGAAATCTGCAATCCGCAACTTGCGGAATAACCCCAATCTCCTCTATGTTCGCCTCCCGAATCTCGTA
TCCTTCATCTGCATAGTCGTCGGTGTCGTCTGGCTACTTCTCCTCCCTCTAAACGAGTATTCCCGACAGACCTAC
ATCTCCGAGAATGCGCTCTTGCCGGGCCAAGTCCATGCGTATTTCACGGGAAGCGAGCAGAACATCTTCCGGGGT
TACAAGAAAGAATTGGAAGGATTGTTGAATGATGGACAGGCGAGAGGCGGCCAAAAAGACGAGGCGGAAGTGACA
GCGGCGCTCTCGGACAAGTTGCAGTCAATCTTGCAAGCGGCGGGCCTTAAAGTTGCCACGCAAAAATACGAATAC
ACCTCCGCTGGGATTACGCACCAGGGCGAGAATACTTATGCCATTATCCATGCGCCGCGCGGTGATGCCACGGAG
GCGATTGTGCTGGTTGCGCCGTGGAAGACGGCTGATGATGAGCTGAACCTGAATGGTGTCACTCTTGCCTTGACA
TTGGCAAGATACTTCAAGAGATGGTCGTTATGGTCCAAGGATATCATCTTCTTAATTCCTCCGGACAGTAAAACT
GGCACTCAGGCTTGGATCGATGCCTACCACGATATGCACCCGGCTTCGGTGCAGCCACTTCCTTTGAAGAGTGGA
GCATTGCAAGGTGCACTAGTCATCGAATACCCATTCGAGCACCGGTTCCAGACCCTCCATATTGTATATGACGGA
GTCAATGGCCAACTCCCTAACCTCGACCTGTTCAATACAGCTGTAGCCATTGCAGGCGGCCAGATGGGCATCGGG
GCCAATCTACAGGAAATGTGGGGTCACGACGACAGCTACGAGCATCGTCTGCAGACTATGTTCCGCGGTATGACC
AAGCAGGGTCTCGGGTATGCCACCGGCGCACACAGCAGCTTCATGCCGTACCATATCGACGCTATCACACTGCAG
ACCAAGGGCGAGGGATGGGAGGATGAGATGGCCCTGGGCCGGACGATTGAGTCTCTTTGTCGCAGCTTGAACAAC
TTGCTAGAGCACCTGCACCAGAGCTTTTTCTTCTACCTGCTCATGCAGTCCAACCGTTTTGTCAGCATTGGAACC
TACTTGCCCAGCGCGATGTTGATCGCTGGAAACTTCACCATCATGGCAATTGCTCTCTGGATACGTACTGGGTAC
TATCCGGAAAGCAAGCCAAGTGCTAAACCAAAGAATGAGAAGGCACCCACCGAAGAGAAGGGGACGAATACTATT
GTCGAAAGGAATACTATCGCAGAACGATACCTTGCTTTACCACTCTCGCTTGTTGTCGGACTCCATCTACTCGGC
CTTGTCCCGCTCTGGGTCTTTAATAATGTCTTCCATCAGTACTTCACAACTACCACCTACATATTTGTGGTCGTG
GACATCATCCTACCCCTTCTCCTTGCCGCAATTCTCTCCAACGGCCTCGGTGTATCAAAACCAATCATCCCCCAA
CAGTACCACCTCATAAAATCCTTCTCCCTCCTCCTACTGGGTCTCTCCCTCTCAACCCTCGCCACCCTCAACTTC
TCCCTTTCATTCATGATTGGTCTGCTCTGCGCGCCACTTAGCTTCATCCCTCGCCTGCGAGGCTCCGTGCCATTC
CGCTTGGCAACCTCCAGTCTGGGTCTGGTGCTTCTCAACCTCGTCTCCCCGCCAGCTGTTCTCCTTGGCGTCTGC
TGGTATATGGGGGTCTCAGTCGAGACTGTCCTCACCCAGGCGGCTTTCGGTTGGGATGTTTGGGGTATGTGGACC
CAGGTCGTTGTTTGGTGTGTGTGGTGGCCGGCTTGGTTGATTGGCTGCGTGTTGCTGGGGTCGTCGATTTTCTGA
Gene >Pro_DTO377G3_2|g5283.t1
ATGGCATTGAAATGTGAGCAAAGAAGCCTAATACCACCTGTCCTTCCTGGCGCCAGCACCGAGGACCCCAACTAA
CAAGATGCCAGCTGCAATCCGCAACTTGCGGAATAACCCCAATCTCCTCTATGTTCGCCTCCCGAATCTCGTATC
CTTCATCTGCATAGTCGTCGGTGTCGTCTGGCTACTTCTCCTCCCTCTAAACGAGTATTCCCGACAGACCTACAT
CTCCGAGAATGCGCTCTTGCCGGGCCAAGTCCATGCGTATTTCACGGGAAGCGAGCAGAACATCTTCCGGGGTTA
CAAGAAAGAATTGGAAGGATTGTTGAATGATGGACAGGCGAGAGGCGGCCAAAAAGACGAGGCGGAAGTGACAGC
GGCGTATGTCAAATGAACCGGGCACAGGCTGGACTATTCGCTGATACTTCGACAGGCTCTCGGACAAGTTGCAGT
CAATCTTGCAAGCGGCGGGCCTTAAAGTTGCCACGCAAAAATACGAATACACCTCCGCTGGGATTACGCACCAGG
GCGAGAATACTTATGCCATTATCCATGCGCCGCGCGGTGATGCCACGGAGGCGATTGTGCTGGTTGCGCCGTGGA
AGACGGCTGATGATGAGCTGAACCTGAATGGTGTCACTCTTGCCTTGACATTGGCAAGATACTTCAAGAGTGAGT
TTCGTGGTTGCGTGCCTCTAGTCGAGTTATTGACAGCTATCTAGGATGGTCGTTATGGTCCAAGGATATCATCTT
CTTAATTCCTCCGGACAGTAAAACTGGCACTCAGGCTTGGATCGATGCCTACCACGATATGCACCCGGCTTCGGT
GCAGCCACTTCCTTTGAAGAGTGGAGCATTGCAAGGTGCACTAGTCATCGAATACCCATTCGAGCACCGGTTCCA
GACCCTCCATATTGTATATGACGGAGTCAATGGCCAACTCCCTAACCTCGACCTGTTCAATACAGCTGTAGCCAT
TGCAGGCGGCCAGATGGGCATCGGGGCCAATCTACAGGAAATGTGGGGTCACGACGACAGCTACGAGCATCGTCT
GCAGACTATGTTCCGCGGTATGACCAAGCAGGGTCTCGGGTATGCCACCGGCGCACACAGCAGCTTCATGCCGTA
CCATATCGACGCTATCACACTGCAGACCAAGGGCGAGGGATGGGAGGATGAGATGGCCCTGGGCCGGACGATTGA
GTCTCTTTGTCGCAGCTTGAACAACTTGCTAGAGCACCTGCACCAGAGCTTTTTCTTCTACCTGCTCATGCAGTC
CAACCGTTTTGTCAGCATTGGAACCTACTTGCCCAGCGCGATGTTGATCGCTGGAAACTTCACCATCATGGCAAT
TGCTCTCTGGATACGTACTGGGTACTATCCGGAAAGCAAGCCAAGTGCTAAACCAAAGAATGAGAAGGCACCCAC
CGAAGAGAAGGGGACGAATACTATTGTCGAAAGGAATACTATCGCAGAACGATACCTTGCTTTACCACTCTCGCT
TGTTGTCGGACTCCATCTACTCGGCCTTGTCCCGCTCTGGGTCTTTAATAATGTCTTCCATCAGGTGAGATCTGC
CAGTCTACAACCACAATGATAATAGCTGCTAACGAATCTACAGTACTTCACAACTACCACCTACATATTTGTGGT
CGTGGACATCATCCTACCCCTTCTCCTTGCCGCAATTCTCTCCAACGGCCTCGGTGTATCAAAACCAATCATCCC
CCAACAGTACCACCTCATAAAATCCTTCTCCCTCCTCCTACTGGGTCTCTCCCTCTCAACCCTCGCCACCCTCAA
CTTCTCCCTTTCATTCATGATTGGTCTGCTCTGCGCGCCACTTAGCTTCATCCCTCGCCTGCGAGGCTCCGTGCC
ATTCCGCTTGGCAACCTCCAGTCTGGGTCTGGTGCTTCTCAACCTCGTCTCCCCGCCAGCTGTTCTCCTTGGCGT
CTGCTGGTATATGGGGGTCTCAGTCGAGACTGTCCTCACCCAGGCGGCTTTCGGTTGGGATGTTTGGGGTATGTG
GACCCAGGTCGTTGTTTGGTGTGTGTGGTGGCCGGCTTGGTTGATTGGCTGCGTGTTGCTGGGGTCGTCGATTTT
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail