Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5279.t1
Gene name
Locationscaffold_12:373541..374304
Strand+
Gene length (bp)763
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13419 HAD_2 Haloacid dehalogenase-like hydrolase 1.1E-11 9 200
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 7.0E-06 7 170
PF13242 Hydrolase_like HAD-hyrolase-like 1.6E-05 155 226

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 621.09 368.89 873.30
5d_25C Five days - 25 degrees Celsius 605.04 357.58 852.51
7d_25C Seven days - 25 degrees Celsius 564.56 332.33 796.80
10d_25C Ten days - 25 degrees Celsius 757.55 440.10 1075.00
7d_15C Seven days - 15 degrees Celsius 350.49 205.21 495.76
7d_30C Seven days - 30 degrees Celsius 479.00 277.38 680.63

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.939313 no
3d_25C 7d_25C 0.755433 no
3d_25C 7d_15C 0.008133 yes
3d_25C 7d_30C 0.286389 no
3d_25C 10d_25C 0.442017 no
5d_25C 7d_25C 0.830039 no
5d_25C 7d_15C 0.013211 yes
5d_25C 7d_30C 0.346084 no
5d_25C 10d_25C 0.368534 no
7d_25C 7d_15C 0.031095 yes
7d_25C 7d_30C 0.543181 no
7d_25C 10d_25C 0.212518 no
7d_15C 7d_30C 0.182419 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.031312 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5279.t1
MCAKILLAFDLYGTLLSTESIQSHLQIHFEPEIARAISEKWRRFQLEYTWRLNSMSRYEDFTEVTRNSLLHALAE
NGQSLDDASISQLMTAYDNLSAFPDVAPALDKLSQESLFKPVIFSNGSNVMVSNSVNRCLSQHASIFHGLLTADD
IQRYKPSRLFYQRLAEQFGKGLANEDIWIISANPFDIVGSRNMGMRAVWVDRAGSGWKDAVIPDLKPTLVVHSLQ
DVTDKIQAYIK*
Coding >Pro_DTO377G3_2|g5279.t1
ATGTGTGCCAAAATACTACTGGCGTTTGATCTGTATGGCACATTGCTGTCCACGGAATCGATTCAAAGTCATCTG
CAGATACATTTCGAGCCAGAAATTGCAAGGGCAATTTCGGAAAAATGGAGACGTTTCCAATTGGAATATACTTGG
AGGCTGAATAGCATGTCACGTTACGAAGATTTCACCGAGGTCACTCGGAATTCCTTGTTGCATGCACTTGCGGAG
AACGGTCAATCGCTTGATGACGCGAGTATATCACAGTTGATGACGGCTTATGATAATCTGTCTGCTTTCCCTGAT
GTCGCGCCAGCGTTGGACAAACTGAGCCAGGAAAGCCTTTTCAAGCCGGTTATCTTCTCCAATGGTAGTAATGTA
ATGGTGTCGAATTCGGTGAATCGTTGCCTCTCGCAGCATGCCAGCATTTTTCACGGGCTTCTCACGGCAGACGAC
ATACAACGTTACAAACCCTCTCGACTATTCTATCAGCGTCTAGCTGAGCAATTCGGCAAGGGACTTGCAAACGAA
GATATATGGATTATCAGCGCTAATCCGTTCGATATTGTCGGATCACGCAACATGGGCATGCGTGCGGTTTGGGTC
GATCGAGCAGGCTCAGGCTGGAAAGACGCTGTGATCCCGGATCTGAAGCCCACACTGGTCGTTCATAGTCTCCAA
GATGTTACCGACAAGATCCAAGCCTATATCAAGTGA
Transcript >Pro_DTO377G3_2|g5279.t1
ATGTGTGCCAAAATACTACTGGCGTTTGATCTGTATGGCACATTGCTGTCCACGGAATCGATTCAAAGTCATCTG
CAGATACATTTCGAGCCAGAAATTGCAAGGGCAATTTCGGAAAAATGGAGACGTTTCCAATTGGAATATACTTGG
AGGCTGAATAGCATGTCACGTTACGAAGATTTCACCGAGGTCACTCGGAATTCCTTGTTGCATGCACTTGCGGAG
AACGGTCAATCGCTTGATGACGCGAGTATATCACAGTTGATGACGGCTTATGATAATCTGTCTGCTTTCCCTGAT
GTCGCGCCAGCGTTGGACAAACTGAGCCAGGAAAGCCTTTTCAAGCCGGTTATCTTCTCCAATGGTAGTAATGTA
ATGGTGTCGAATTCGGTGAATCGTTGCCTCTCGCAGCATGCCAGCATTTTTCACGGGCTTCTCACGGCAGACGAC
ATACAACGTTACAAACCCTCTCGACTATTCTATCAGCGTCTAGCTGAGCAATTCGGCAAGGGACTTGCAAACGAA
GATATATGGATTATCAGCGCTAATCCGTTCGATATTGTCGGATCACGCAACATGGGCATGCGTGCGGTTTGGGTC
GATCGAGCAGGCTCAGGCTGGAAAGACGCTGTGATCCCGGATCTGAAGCCCACACTGGTCGTTCATAGTCTCCAA
GATGTTACCGACAAGATCCAAGCCTATATCAAGTGA
Gene >Pro_DTO377G3_2|g5279.t1
ATGTGTGCCAAAATACTACTGGCGTTTGATCTGTATGGCACATTGCTGTCCACGGAATCGATTCAAAGTCATCTG
CAGATACATTTCGAGCCAGAAATTGCAAGGGCAATTTCGGAAAAATGGAGACGTTTCCAATTGGAATATACTTGG
AGGCTGAATAGCATGTGTGAGCTGCCTAGAATGTTCCTTGCATCGATAGCAGAGCTGACTCATGATAGCACGTTA
CGAAGATTTCACCGAGGTCACTCGGAATTCCTTGTTGCATGCACTTGCGGAGAACGGTCAATCGCTTGATGACGC
GAGTATATCACAGTTGATGACGGCTTATGATAATCTGTCTGCTTTCCCTGATGTCGCGCCAGCGTTGGACAAACT
GAGCCAGGAAAGCCTTTTCAAGCCGGTTATCTTCTCCAATGGTAGTAATGTAATGGTGTCGAATTCGGTGAATCG
TTGCCTCTCGCAGCATGCCAGCATTTTTCACGGGCTTCTCACGGCAGACGACATACAACGTTACAAACCCTCTCG
ACTATTCTATCAGCGTCTAGCTGAGCAATTCGGCAAGGGACTTGCAAACGAAGATATATGGATTATCAGCGCTAA
TCCGTTCGATATTGTCGGATCACGCAACATGGGCATGCGTGCGGTTTGGGTCGATCGAGCAGGCTCAGGCTGGAA
AGACGCTGTGATCCCGGATCTGAAGCCCACACTGGTCGTTCATAGTCTCCAAGATGTTACCGACAAGATCCAAGC
CTATATCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail