Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g527.t1
Gene name
Locationscaffold_01:1351416..1353333
Strand-
Gene length (bp)1917
Transcript length (bp)1659
Coding sequence length (bp)1659
Protein length (aa) 553

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00514 Arm Armadillo/beta-catenin-like repeat 5.0E-09 115 154
PF00514 Arm Armadillo/beta-catenin-like repeat 4.1E-14 157 195
PF00514 Arm Armadillo/beta-catenin-like repeat 1.5E-09 198 239
PF00514 Arm Armadillo/beta-catenin-like repeat 1.3E-04 251 281
PF00514 Arm Armadillo/beta-catenin-like repeat 3.5E-07 284 322
PF00514 Arm Armadillo/beta-catenin-like repeat 1.3E-11 325 364
PF00514 Arm Armadillo/beta-catenin-like repeat 1.7E-12 367 406
PF00514 Arm Armadillo/beta-catenin-like repeat 7.8E-08 413 450
PF01749 IBB Importin beta binding domain 1.3E-26 10 104
PF16186 Arm_3 Atypical Arm repeat 1.9E-23 469 523
PF13513 HEAT_EZ HEAT-like repeat 1.3E-08 141 194
PF13646 HEAT_2 HEAT repeats 6.8E-08 129 229
PF02985 HEAT HEAT repeat 3.5E-06 169 195

GO

GO Term Description Terminal node
GO:0061608 nuclear import signal receptor activity Yes
GO:0006606 protein import into nucleus Yes
GO:0005515 protein binding Yes
GO:0051641 cellular localization No
GO:0046907 intracellular transport No
GO:0008104 protein localization No
GO:0051234 establishment of localization No
GO:0070727 cellular macromolecule localization No
GO:0071702 organic substance transport No
GO:0042886 amide transport No
GO:0051649 establishment of localization in cell No
GO:0006913 nucleocytoplasmic transport No
GO:0034504 protein localization to nucleus No
GO:0051170 import into nucleus No
GO:0017038 protein import No
GO:0051179 localization No
GO:0140104 molecular carrier activity No
GO:0033365 protein localization to organelle No
GO:0045184 establishment of protein localization No
GO:0051169 nuclear transport No
GO:0140142 nucleocytoplasmic carrier activity No
GO:0072594 establishment of protein localization to organelle No
GO:0071705 nitrogen compound transport No
GO:0015833 peptide transport No
GO:0033036 macromolecule localization No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0015031 protein transport No
GO:0006886 intracellular protein transport No
GO:0005488 binding No
GO:0034613 cellular protein localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g527.t1
MAERYIPEHRRTQFKAKNQFKPDELRRRREEQQVEIRKAKRDENLAKRRGIQTQDGRIGVGGMAAATESDDEASA
IESELNVELPQMVKGVFSDQVEEQIQATTKFRKLLSKERNPPIERVIETGVVARFVEFLRSPHTLVQFESAWALT
NIASGSAQQTQVVIEAGAVPIFVELLSSPEPDVREQAVWALGNIAGDSPHCRDFVLGAGALRPLLNLINDGRKLS
MLRNATWTLSNFCRGKTPQPDWNTIAPALPVLAKLIYMLDDEVLIDACWAISYLSDGANDKIQAVIEAGIPRRLV
ELLMHASTSVQTPALRSVGNIVTGDDVQTQVIINCGSLPALLSLLSSTKDGIRKEACWTISNVTAGNSSQIQAVI
DAGIIAPLINLLANGDFKTRKEACWAISNATSGGLQKPDQIRYLVSQGCIKPLCDLLACPDNKIIQVALDGLENI
LKVGDMDKEAGQPGEARVNRYALFIEEAGGMEKIHDCQNNANEEIYMKAYNIIEKYFSDEDEAGGDIEELAPQQT
QTGFALGTGQQQPGGFNFGNGGDTMDM*
Coding >Pro_DTO377G3_2|g527.t1
ATGGCGGAACGCTATATTCCCGAGCATCGCCGCACACAGTTCAAGGCCAAGAACCAGTTCAAGCCCGATGAGCTC
CGCCGCCGCCGTGAAGAACAGCAGGTCGAGATTCGCAAGGCTAAGCGTGATGAGAACTTAGCCAAGAGACGTGGT
ATCCAAACTCAGGACGGTAGAATCGGTGTTGGTGGCATGGCTGCCGCCACTGAGAGTGATGATGAGGCCAGTGCT
ATTGAGAGTGAGCTCAACGTCGAGCTTCCCCAGATGGTGAAGGGAGTTTTCTCAGATCAGGTTGAGGAACAGATC
CAGGCCACCACCAAGTTCCGCAAATTGCTTTCCAAGGAGCGCAACCCCCCTATCGAGCGTGTTATTGAGACCGGT
GTCGTAGCCCGTTTCGTCGAGTTCCTTCGCTCACCCCACACCCTGGTTCAGTTTGAGTCTGCCTGGGCTTTGACC
AACATTGCTTCCGGTTCCGCCCAGCAGACCCAGGTCGTCATTGAAGCTGGTGCCGTCCCCATCTTCGTCGAGTTG
CTTAGCAGCCCTGAGCCCGATGTTCGTGAACAGGCCGTTTGGGCCCTCGGAAACATTGCTGGTGACAGCCCTCAC
TGCCGTGACTTTGTCCTCGGTGCCGGTGCCCTGCGCCCGCTTCTTAACCTCATCAACGATGGCCGCAAGCTGAGC
ATGCTCCGCAACGCTACTTGGACTCTTAGCAACTTCTGCCGTGGCAAGACTCCCCAGCCTGACTGGAACACTATT
GCCCCCGCCCTTCCAGTCCTTGCCAAGCTCATCTACATGCTGGATGACGAGGTCCTGATTGACGCTTGCTGGGCT
ATCTCTTACTTGTCCGATGGTGCCAACGACAAGATTCAGGCCGTTATCGAGGCCGGTATCCCCCGTCGCCTGGTG
GAGCTCCTTATGCACGCCTCTACCTCTGTCCAGACTCCCGCTCTCCGTTCCGTGGGTAACATTGTCACTGGTGAT
GACGTCCAGACCCAGGTGATCATTAACTGTGGCTCTCTTCCTGCTCTGCTCTCCCTCCTGAGCTCCACCAAGGAT
GGTATCCGCAAGGAAGCTTGCTGGACCATCTCCAACGTCACTGCCGGTAACTCCAGCCAGATTCAGGCGGTCATC
GACGCTGGCATCATTGCTCCCCTTATCAACCTTCTTGCCAATGGTGACTTCAAGACCCGCAAGGAGGCTTGCTGG
GCTATCTCTAACGCTACTTCCGGTGGTCTCCAGAAGCCCGATCAGATCCGCTACCTTGTTTCTCAAGGCTGCATC
AAACCCCTGTGCGATCTCCTGGCCTGCCCTGACAATAAGATCATCCAGGTCGCTCTCGACGGTCTCGAGAACATC
CTCAAGGTCGGAGATATGGACAAGGAGGCTGGCCAGCCCGGTGAGGCTCGTGTCAACCGCTACGCTCTCTTCATC
GAAGAGGCCGGTGGCATGGAGAAGATTCACGATTGCCAGAACAACGCCAACGAGGAGATCTACATGAAGGCCTAC
AACATTATCGAGAAGTACTTCTCTGACGAGGATGAGGCCGGTGGCGATATCGAGGAACTTGCTCCCCAACAGACC
CAGACTGGATTTGCTCTCGGCACTGGCCAGCAGCAACCTGGTGGCTTCAACTTCGGCAACGGCGGTGATACCATG
GATATGTAA
Transcript >Pro_DTO377G3_2|g527.t1
ATGGCGGAACGCTATATTCCCGAGCATCGCCGCACACAGTTCAAGGCCAAGAACCAGTTCAAGCCCGATGAGCTC
CGCCGCCGCCGTGAAGAACAGCAGGTCGAGATTCGCAAGGCTAAGCGTGATGAGAACTTAGCCAAGAGACGTGGT
ATCCAAACTCAGGACGGTAGAATCGGTGTTGGTGGCATGGCTGCCGCCACTGAGAGTGATGATGAGGCCAGTGCT
ATTGAGAGTGAGCTCAACGTCGAGCTTCCCCAGATGGTGAAGGGAGTTTTCTCAGATCAGGTTGAGGAACAGATC
CAGGCCACCACCAAGTTCCGCAAATTGCTTTCCAAGGAGCGCAACCCCCCTATCGAGCGTGTTATTGAGACCGGT
GTCGTAGCCCGTTTCGTCGAGTTCCTTCGCTCACCCCACACCCTGGTTCAGTTTGAGTCTGCCTGGGCTTTGACC
AACATTGCTTCCGGTTCCGCCCAGCAGACCCAGGTCGTCATTGAAGCTGGTGCCGTCCCCATCTTCGTCGAGTTG
CTTAGCAGCCCTGAGCCCGATGTTCGTGAACAGGCCGTTTGGGCCCTCGGAAACATTGCTGGTGACAGCCCTCAC
TGCCGTGACTTTGTCCTCGGTGCCGGTGCCCTGCGCCCGCTTCTTAACCTCATCAACGATGGCCGCAAGCTGAGC
ATGCTCCGCAACGCTACTTGGACTCTTAGCAACTTCTGCCGTGGCAAGACTCCCCAGCCTGACTGGAACACTATT
GCCCCCGCCCTTCCAGTCCTTGCCAAGCTCATCTACATGCTGGATGACGAGGTCCTGATTGACGCTTGCTGGGCT
ATCTCTTACTTGTCCGATGGTGCCAACGACAAGATTCAGGCCGTTATCGAGGCCGGTATCCCCCGTCGCCTGGTG
GAGCTCCTTATGCACGCCTCTACCTCTGTCCAGACTCCCGCTCTCCGTTCCGTGGGTAACATTGTCACTGGTGAT
GACGTCCAGACCCAGGTGATCATTAACTGTGGCTCTCTTCCTGCTCTGCTCTCCCTCCTGAGCTCCACCAAGGAT
GGTATCCGCAAGGAAGCTTGCTGGACCATCTCCAACGTCACTGCCGGTAACTCCAGCCAGATTCAGGCGGTCATC
GACGCTGGCATCATTGCTCCCCTTATCAACCTTCTTGCCAATGGTGACTTCAAGACCCGCAAGGAGGCTTGCTGG
GCTATCTCTAACGCTACTTCCGGTGGTCTCCAGAAGCCCGATCAGATCCGCTACCTTGTTTCTCAAGGCTGCATC
AAACCCCTGTGCGATCTCCTGGCCTGCCCTGACAATAAGATCATCCAGGTCGCTCTCGACGGTCTCGAGAACATC
CTCAAGGTCGGAGATATGGACAAGGAGGCTGGCCAGCCCGGTGAGGCTCGTGTCAACCGCTACGCTCTCTTCATC
GAAGAGGCCGGTGGCATGGAGAAGATTCACGATTGCCAGAACAACGCCAACGAGGAGATCTACATGAAGGCCTAC
AACATTATCGAGAAGTACTTCTCTGACGAGGATGAGGCCGGTGGCGATATCGAGGAACTTGCTCCCCAACAGACC
CAGACTGGATTTGCTCTCGGCACTGGCCAGCAGCAACCTGGTGGCTTCAACTTCGGCAACGGCGGTGATACCATG
GATATGTAA
Gene >Pro_DTO377G3_2|g527.t1
ATGGCGGAACGCTATATTCCCGAGCATCGCCGCACACAGTTCAAGGCCAAGAACCAGTTCAAGCCCGATGAGCTC
CGCCGCCGCCGTGAAGAACAGCAGGTCGAGATTCGCAAGGCTAAGCGTGATGAGAACTTAGCCAAGAGACGTGGT
ATCCAAACTCAGGACGGTAGAATCGGTGTTGGTGGCATGGCTGCCGCCACTGAGAGTGATGATGAGGCCAGTGCT
ATTGAGAGTGAGGTAGGTCTTTCAATTTTTCTTTGATCCTTTGAAATCTGTTCTATTCTATATCCTCCTTTGGAT
TTCTACGGGCTCATGGTGTGGTCACCACCTTTATGGGCCCTGAGTGAATTCTTTGTTTTCATGATGCGATCATCA
ACAAGGATTTTTTTTCACCGCCCTGTTGCCATGGCCCACGAAGACCCCTCTGACTTGACCCCACTGCAATAAAAA
AAAAACATCGTGAAAATTACCAAGCTAACATAATGATTTATTCAGCTCAACGTCGAGCTTCCCCAGATGGTGAAG
GGAGTTTTCTCAGATCAGGTTGAGGAACAGATCCAGGCCACCACCAAGTTCCGCAAATTGCTTTCCAAGGAGCGC
AACCCCCCTATCGAGCGTGTTATTGAGACCGGTGTCGTAGCCCGTTTCGTCGAGTTCCTTCGCTCACCCCACACC
CTGGTTCAGTTTGAGTCTGCCTGGGCTTTGACCAACATTGCTTCCGGTTCCGCCCAGCAGACCCAGGTCGTCATT
GAAGCTGGTGCCGTCCCCATCTTCGTCGAGTTGCTTAGCAGCCCTGAGCCCGATGTTCGTGAACAGGCCGTTTGG
GCCCTCGGAAACATTGCTGGTGACAGCCCTCACTGCCGTGACTTTGTCCTCGGTGCCGGTGCCCTGCGCCCGCTT
CTTAACCTCATCAACGATGGCCGCAAGCTGAGCATGCTCCGCAACGCTACTTGGACTCTTAGCAACTTCTGCCGT
GGCAAGACTCCCCAGCCTGACTGGAACACTATTGCCCCCGCCCTTCCAGTCCTTGCCAAGCTCATCTACATGCTG
GATGACGAGGTCCTGATTGACGCTTGCTGGGCTATCTCTTACTTGTCCGATGGTGCCAACGACAAGATTCAGGCC
GTTATCGAGGCCGGTATCCCCCGTCGCCTGGTGGAGCTCCTTATGCACGCCTCTACCTCTGTCCAGACTCCCGCT
CTCCGTTCCGTGGGTAACATTGTCACTGGTGATGACGTCCAGACCCAGGTGATCATTAACTGTGGCTCTCTTCCT
GCTCTGCTCTCCCTCCTGAGCTCCACCAAGGATGGTATCCGCAAGGAAGCTTGCTGGACCATCTCCAACGTCACT
GCCGGTAACTCCAGCCAGATTCAGGCGGTCATCGACGCTGGCATCATTGCTCCCCTTATCAACCTTCTTGCCAAT
GGTGACTTCAAGACCCGCAAGGAGGCTTGCTGGGCTATCTCTAACGCTACTTCCGGTGGTCTCCAGAAGCCCGAT
CAGATCCGCTACCTTGTTTCTCAAGGCTGCATCAAACCCCTGTGCGATCTCCTGGCCTGCCCTGACAATAAGATC
ATCCAGGTCGCTCTCGACGGTCTCGAGAACATCCTCAAGGTCGGAGATATGGACAAGGAGGCTGGCCAGCCCGGT
GAGGCTCGTGTCAACCGCTACGCTCTCTTCATCGAAGAGGCCGGTGGCATGGAGAAGATTCACGATTGCCAGAAC
AACGCCAACGAGGAGATCTACATGAAGGCCTACAACATTATCGAGAAGTACTTCTCTGACGAGGATGAGGCCGGT
GGCGATATCGAGGAACTTGCTCCCCAACAGACCCAGACTGGATTTGCTCTCGGCACTGGCCAGCAGCAACCTGGT
GGCTTCAACTTCGGCAACGGCGGTGATACCATGGATATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail