Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5260.t1
Gene name
Locationscaffold_12:323549..327284
Strand-
Gene length (bp)3735
Transcript length (bp)3540
Coding sequence length (bp)3540
Protein length (aa) 1180

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2_N SNF2 family N-terminal domain 1.5E-64 498 806
PF00271 Helicase_C Helicase conserved C-terminal domain 6.1E-16 1006 1119
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 4.7E-08 848 876
PF04851 ResIII Type III restriction enzyme, res subunit 2.2E-06 486 670
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 2.6E-06 845 905
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.8E-04 848 879

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0005524 ATP binding Yes
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003676 nucleic acid binding No
GO:0005488 binding No
GO:0043169 cation binding No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5260.t1
MASSVDQSQEDKIKDLLEDLDTYRYIYDDLLATRGPCAEADELRDTIKNMEVQVATLLGDPVPTSQAAPTPQVTS
PTPPVRTPAATPRKASNTFTGIPGDSFASPHWPSAAPSPFAAGSGQSILLPASSMIQPSPDNSRKRQRPLSQVSP
TIQGSSKRIAPSQPKSHRSKLDEIDAAQEARLAENQRLYKHWIDAAGDDADEINELREECEEQAKLIETEFQMER
DAELARALQADEDHSQLPRSNERHTWNIPDRSQPVKLEHLSSNPNRAPQAYAPIAPFNKLNPFNSDDDLQEITAD
SFKDRSGKQPARPSSSYPHLPSLPSQYSKSPYTSQGLYPSRMPYPSELTYPSQLPYPSELTYPSQMSYPSQLPYP
SQLAYPSQLSNSSMPYSTSAAASRNLPWSHEHPYATMPGTFEKYDKFDKFDKAFDLVRNQSEIFDDDADIVAYNE
KEFPEDIKNLLSGIKDIREATKADNDETPSALRVTLMKHQKIGLRWMKAKEESNHKGGILADDMGLGKTIQAIAL
MVARPFEDEDRRPTLIVAPKALMDQWRLEIQRHVKPGRHQLSVLIYHQRRRPWKELKRYDIIITTFGTITAHYKT
LLQAEKLAEEGRDPSIIQDLKNAAGPLSPAAKWHRVIIDEAQNIKNPSAKSAIACCRLNATYRWCLTGTPMMNRL
EDFQSLLGFLRIRPYSNPAKFKADFVRRIKSGWGGEDVMKQLRVLVKSVCLRRTKSSKIDGEPILQLPPKVTEKV
HVVFDERESQVYEELNTSTQRQITRYLDSGTLGRNYSHVLVLLLRLRQACCHPLLMQDFRNEPSPSIPGVDKIAN
AKLLTAAVVQRIKDNDGEEDGTCPVCMDSVKNATIYIPCGHHVCSECWIRISDSATANGAINLEDDGPAVIKCQN
CRGPVDPAKLTDTNAFKQVHDPTSVPEFAAGGGDTNGPNDDEDPEATASSEESDSDSSTGEGDAESKKKTKAKSL
AQLRKDALRNKAEKKKYIRRLEKGWFPSTKITKTLEILQANEDRGLEEKTIIFSQFTSLLDLLEVPLARRGWNHT
RFDGSMNLKERNAAVTAFTNDPDCKIMLVSLKAGNSGLNLVAASHVIMFDPFWNPYIEDQAVDRAHRIGQVREVF
VHRLLIENTVEDRIVTLQDQKRELISGALDEGGTMNVSRLDARELAYLFGVRDL*
Coding >Pro_DTO377G3_2|g5260.t1
ATGGCTTCTTCGGTCGATCAGTCCCAAGAGGACAAGATCAAAGACCTTTTGGAGGATCTCGATACCTACAGATAC
ATATACGATGATCTCCTCGCGACGCGGGGTCCTTGTGCAGAAGCAGATGAGCTTCGTGATACCATCAAAAATATG
GAAGTCCAGGTTGCCACGCTCCTTGGTGATCCTGTTCCTACTTCTCAAGCCGCCCCAACACCACAAGTGACATCC
CCTACTCCGCCAGTCCGGACGCCTGCGGCTACTCCACGCAAGGCGTCCAACACTTTCACTGGAATCCCCGGGGAT
TCATTTGCGTCCCCTCACTGGCCTTCTGCTGCACCCTCACCTTTCGCGGCCGGATCTGGCCAATCGATATTGCTG
CCAGCTTCATCAATGATACAGCCTTCTCCAGATAATTCCCGTAAACGCCAGCGTCCGCTATCTCAGGTCTCGCCC
ACGATCCAGGGATCATCAAAAAGGATTGCTCCCTCGCAGCCTAAATCTCACAGATCTAAACTCGACGAGATAGAT
GCTGCACAAGAAGCCCGCCTTGCCGAGAATCAGCGCTTGTACAAGCACTGGATCGATGCGGCAGGTGACGATGCA
GATGAAATAAACGAACTTCGGGAAGAGTGTGAGGAGCAGGCGAAGTTGATTGAAACAGAGTTTCAAATGGAACGA
GACGCGGAATTGGCTCGCGCGCTCCAAGCCGACGAGGATCATAGTCAACTCCCCCGTTCCAATGAGCGTCATACA
TGGAATATTCCTGACCGCAGTCAACCGGTAAAACTCGAACATCTTTCATCAAACCCCAATCGTGCACCTCAAGCA
TATGCCCCGATAGCCCCATTCAATAAACTCAATCCATTCAATTCCGACGATGATCTTCAAGAAATCACAGCCGAT
TCATTCAAAGATCGATCCGGCAAGCAGCCAGCCCGCCCATCCAGTTCATATCCCCACCTGCCATCTCTCCCTTCG
CAGTATTCCAAATCACCGTACACTTCACAGGGACTTTATCCCTCGCGGATGCCATATCCCTCCGAGTTGACATAC
CCCTCTCAATTGCCATATCCCTCCGAGTTGACATATCCCTCCCAAATGTCATATCCTTCCCAATTGCCGTATCCT
TCGCAGCTGGCCTATCCCTCCCAATTGTCAAATTCCTCAATGCCATATTCCACATCAGCAGCTGCCTCCAGAAAC
CTTCCCTGGTCGCATGAGCATCCGTACGCTACAATGCCGGGTACATTTGAGAAGTATGACAAATTCGACAAGTTT
GACAAGGCCTTTGACCTGGTTCGCAACCAAAGCGAAATATTCGACGACGATGCTGACATAGTGGCCTACAACGAG
AAGGAGTTTCCTGAAGATATCAAGAACTTGCTCAGCGGTATCAAAGATATTCGAGAGGCAACTAAAGCGGACAAT
GATGAGACACCAAGTGCTCTTCGAGTCACGTTGATGAAGCATCAGAAGATTGGCCTGAGATGGATGAAGGCCAAA
GAAGAGAGCAACCACAAAGGAGGAATTCTTGCAGATGACATGGGACTTGGTAAAACCATCCAAGCGATTGCACTG
ATGGTTGCTCGCCCATTCGAGGATGAAGACCGACGCCCGACTTTGATTGTCGCGCCCAAGGCACTTATGGATCAA
TGGAGACTTGAAATCCAGCGTCATGTCAAGCCGGGCAGGCACCAATTATCAGTCTTGATCTACCATCAACGGCGC
AGGCCCTGGAAGGAGCTCAAAAGGTATGATATCATTATCACTACGTTTGGTACAATCACTGCGCACTACAAAACA
TTGCTCCAGGCGGAAAAGTTGGCAGAGGAAGGGCGGGATCCCTCGATAATCCAAGACCTCAAAAATGCGGCCGGT
CCTCTCAGTCCTGCTGCCAAGTGGCATCGCGTCATCATCGATGAAGCACAGAACATCAAGAACCCAAGTGCGAAA
TCGGCAATAGCATGTTGTCGACTCAATGCTACCTACCGCTGGTGTCTGACTGGTACGCCTATGATGAATCGTCTC
GAAGATTTCCAGTCCCTTTTGGGATTCCTCCGGATTCGGCCTTATAGCAACCCAGCAAAGTTTAAGGCGGACTTC
GTGAGACGCATTAAATCTGGTTGGGGAGGCGAAGATGTCATGAAGCAACTACGCGTTCTAGTCAAGTCTGTCTGT
CTCCGACGCACAAAATCCTCCAAGATTGATGGCGAGCCCATCTTGCAACTCCCACCAAAGGTCACCGAGAAGGTC
CATGTTGTGTTTGATGAGAGAGAAAGCCAGGTTTATGAGGAACTCAATACGTCCACTCAAAGGCAGATCACCCGG
TACCTTGACTCAGGCACGTTGGGCAGGAACTACAGCCATGTTCTAGTTCTCCTTCTCCGTCTTCGGCAGGCATGC
TGCCATCCACTTCTCATGCAGGATTTCCGAAACGAACCCTCCCCGTCTATCCCGGGGGTGGATAAGATCGCCAAC
GCTAAACTTCTGACCGCTGCTGTAGTGCAACGTATCAAAGATAATGACGGCGAAGAGGATGGCACCTGCCCTGTC
TGCATGGACAGTGTCAAAAATGCGACTATTTACATTCCATGTGGACACCATGTGTGCTCGGAGTGCTGGATCCGC
ATTTCCGACTCTGCAACTGCAAACGGAGCCATCAACCTCGAAGACGATGGTCCAGCTGTGATTAAGTGCCAGAAC
TGCCGAGGGCCCGTGGACCCTGCGAAACTCACCGACACCAATGCATTCAAGCAGGTCCACGATCCAACCTCAGTG
CCCGAATTTGCCGCCGGAGGCGGTGATACCAACGGGCCCAATGACGACGAAGACCCAGAAGCAACAGCGAGCAGT
GAAGAGTCTGACTCCGATAGCTCTACTGGAGAGGGCGATGCGGAATCAAAGAAGAAAACGAAGGCGAAGTCTCTA
GCCCAGCTGCGCAAGGACGCTTTGAGGAACAAGGCCGAGAAGAAGAAATACATTCGCCGCCTCGAGAAGGGCTGG
TTCCCCAGCACAAAAATCACAAAGACGCTGGAGATCCTCCAAGCCAATGAAGACCGCGGCTTAGAGGAGAAAACT
ATCATTTTCAGCCAGTTCACCTCCCTCTTGGATCTTCTCGAAGTCCCCCTGGCCCGCCGCGGCTGGAACCACACC
CGCTTCGACGGCAGCATGAATCTGAAGGAGCGCAACGCCGCTGTGACGGCTTTCACCAATGATCCTGACTGCAAG
ATCATGCTCGTCTCCCTCAAGGCCGGCAACTCCGGTCTGAACCTCGTCGCCGCTTCGCATGTCATCATGTTCGAC
CCCTTCTGGAACCCGTACATTGAAGACCAGGCCGTTGATCGTGCCCATCGCATCGGGCAGGTTAGAGAGGTCTTC
GTTCACCGTCTGCTTATCGAGAATACTGTTGAGGACCGCATTGTTACTCTTCAGGACCAGAAGCGTGAGCTTATC
AGTGGTGCTCTCGATGAGGGCGGTACCATGAATGTCTCCCGACTAGATGCGAGGGAACTTGCTTATCTCTTCGGT
GTGAGAGACTTGTAA
Transcript >Pro_DTO377G3_2|g5260.t1
ATGGCTTCTTCGGTCGATCAGTCCCAAGAGGACAAGATCAAAGACCTTTTGGAGGATCTCGATACCTACAGATAC
ATATACGATGATCTCCTCGCGACGCGGGGTCCTTGTGCAGAAGCAGATGAGCTTCGTGATACCATCAAAAATATG
GAAGTCCAGGTTGCCACGCTCCTTGGTGATCCTGTTCCTACTTCTCAAGCCGCCCCAACACCACAAGTGACATCC
CCTACTCCGCCAGTCCGGACGCCTGCGGCTACTCCACGCAAGGCGTCCAACACTTTCACTGGAATCCCCGGGGAT
TCATTTGCGTCCCCTCACTGGCCTTCTGCTGCACCCTCACCTTTCGCGGCCGGATCTGGCCAATCGATATTGCTG
CCAGCTTCATCAATGATACAGCCTTCTCCAGATAATTCCCGTAAACGCCAGCGTCCGCTATCTCAGGTCTCGCCC
ACGATCCAGGGATCATCAAAAAGGATTGCTCCCTCGCAGCCTAAATCTCACAGATCTAAACTCGACGAGATAGAT
GCTGCACAAGAAGCCCGCCTTGCCGAGAATCAGCGCTTGTACAAGCACTGGATCGATGCGGCAGGTGACGATGCA
GATGAAATAAACGAACTTCGGGAAGAGTGTGAGGAGCAGGCGAAGTTGATTGAAACAGAGTTTCAAATGGAACGA
GACGCGGAATTGGCTCGCGCGCTCCAAGCCGACGAGGATCATAGTCAACTCCCCCGTTCCAATGAGCGTCATACA
TGGAATATTCCTGACCGCAGTCAACCGGTAAAACTCGAACATCTTTCATCAAACCCCAATCGTGCACCTCAAGCA
TATGCCCCGATAGCCCCATTCAATAAACTCAATCCATTCAATTCCGACGATGATCTTCAAGAAATCACAGCCGAT
TCATTCAAAGATCGATCCGGCAAGCAGCCAGCCCGCCCATCCAGTTCATATCCCCACCTGCCATCTCTCCCTTCG
CAGTATTCCAAATCACCGTACACTTCACAGGGACTTTATCCCTCGCGGATGCCATATCCCTCCGAGTTGACATAC
CCCTCTCAATTGCCATATCCCTCCGAGTTGACATATCCCTCCCAAATGTCATATCCTTCCCAATTGCCGTATCCT
TCGCAGCTGGCCTATCCCTCCCAATTGTCAAATTCCTCAATGCCATATTCCACATCAGCAGCTGCCTCCAGAAAC
CTTCCCTGGTCGCATGAGCATCCGTACGCTACAATGCCGGGTACATTTGAGAAGTATGACAAATTCGACAAGTTT
GACAAGGCCTTTGACCTGGTTCGCAACCAAAGCGAAATATTCGACGACGATGCTGACATAGTGGCCTACAACGAG
AAGGAGTTTCCTGAAGATATCAAGAACTTGCTCAGCGGTATCAAAGATATTCGAGAGGCAACTAAAGCGGACAAT
GATGAGACACCAAGTGCTCTTCGAGTCACGTTGATGAAGCATCAGAAGATTGGCCTGAGATGGATGAAGGCCAAA
GAAGAGAGCAACCACAAAGGAGGAATTCTTGCAGATGACATGGGACTTGGTAAAACCATCCAAGCGATTGCACTG
ATGGTTGCTCGCCCATTCGAGGATGAAGACCGACGCCCGACTTTGATTGTCGCGCCCAAGGCACTTATGGATCAA
TGGAGACTTGAAATCCAGCGTCATGTCAAGCCGGGCAGGCACCAATTATCAGTCTTGATCTACCATCAACGGCGC
AGGCCCTGGAAGGAGCTCAAAAGGTATGATATCATTATCACTACGTTTGGTACAATCACTGCGCACTACAAAACA
TTGCTCCAGGCGGAAAAGTTGGCAGAGGAAGGGCGGGATCCCTCGATAATCCAAGACCTCAAAAATGCGGCCGGT
CCTCTCAGTCCTGCTGCCAAGTGGCATCGCGTCATCATCGATGAAGCACAGAACATCAAGAACCCAAGTGCGAAA
TCGGCAATAGCATGTTGTCGACTCAATGCTACCTACCGCTGGTGTCTGACTGGTACGCCTATGATGAATCGTCTC
GAAGATTTCCAGTCCCTTTTGGGATTCCTCCGGATTCGGCCTTATAGCAACCCAGCAAAGTTTAAGGCGGACTTC
GTGAGACGCATTAAATCTGGTTGGGGAGGCGAAGATGTCATGAAGCAACTACGCGTTCTAGTCAAGTCTGTCTGT
CTCCGACGCACAAAATCCTCCAAGATTGATGGCGAGCCCATCTTGCAACTCCCACCAAAGGTCACCGAGAAGGTC
CATGTTGTGTTTGATGAGAGAGAAAGCCAGGTTTATGAGGAACTCAATACGTCCACTCAAAGGCAGATCACCCGG
TACCTTGACTCAGGCACGTTGGGCAGGAACTACAGCCATGTTCTAGTTCTCCTTCTCCGTCTTCGGCAGGCATGC
TGCCATCCACTTCTCATGCAGGATTTCCGAAACGAACCCTCCCCGTCTATCCCGGGGGTGGATAAGATCGCCAAC
GCTAAACTTCTGACCGCTGCTGTAGTGCAACGTATCAAAGATAATGACGGCGAAGAGGATGGCACCTGCCCTGTC
TGCATGGACAGTGTCAAAAATGCGACTATTTACATTCCATGTGGACACCATGTGTGCTCGGAGTGCTGGATCCGC
ATTTCCGACTCTGCAACTGCAAACGGAGCCATCAACCTCGAAGACGATGGTCCAGCTGTGATTAAGTGCCAGAAC
TGCCGAGGGCCCGTGGACCCTGCGAAACTCACCGACACCAATGCATTCAAGCAGGTCCACGATCCAACCTCAGTG
CCCGAATTTGCCGCCGGAGGCGGTGATACCAACGGGCCCAATGACGACGAAGACCCAGAAGCAACAGCGAGCAGT
GAAGAGTCTGACTCCGATAGCTCTACTGGAGAGGGCGATGCGGAATCAAAGAAGAAAACGAAGGCGAAGTCTCTA
GCCCAGCTGCGCAAGGACGCTTTGAGGAACAAGGCCGAGAAGAAGAAATACATTCGCCGCCTCGAGAAGGGCTGG
TTCCCCAGCACAAAAATCACAAAGACGCTGGAGATCCTCCAAGCCAATGAAGACCGCGGCTTAGAGGAGAAAACT
ATCATTTTCAGCCAGTTCACCTCCCTCTTGGATCTTCTCGAAGTCCCCCTGGCCCGCCGCGGCTGGAACCACACC
CGCTTCGACGGCAGCATGAATCTGAAGGAGCGCAACGCCGCTGTGACGGCTTTCACCAATGATCCTGACTGCAAG
ATCATGCTCGTCTCCCTCAAGGCCGGCAACTCCGGTCTGAACCTCGTCGCCGCTTCGCATGTCATCATGTTCGAC
CCCTTCTGGAACCCGTACATTGAAGACCAGGCCGTTGATCGTGCCCATCGCATCGGGCAGGTTAGAGAGGTCTTC
GTTCACCGTCTGCTTATCGAGAATACTGTTGAGGACCGCATTGTTACTCTTCAGGACCAGAAGCGTGAGCTTATC
AGTGGTGCTCTCGATGAGGGCGGTACCATGAATGTCTCCCGACTAGATGCGAGGGAACTTGCTTATCTCTTCGGT
GTGAGAGACTTGTAA
Gene >Pro_DTO377G3_2|g5260.t1
ATGGCTTCTTCGGTCGATCAGTCCCAAGAGGACAAGATCAAAGACCTTTTGGAGGATCTCGATACCTACAGATAC
ATATACGATGATCTCCTCGCGACGCGGGGTCCTTGTGCAGAAGCAGATGAGCTTCGTGATACCATCAAAAATATG
GAAGTCCAGGTTGCCACGCTCCTTGGTGATCCTGTTCCTACTTCTCAAGCCGCCCCAACACCACAAGTGACATCC
CCTACTCCGCCAGTCCGGACGCCTGCGGCTACTCCACGCAAGGCGTCCAACACTTTCACTGGAATCCCCGGGGAT
TCATTTGCGTCCCCTCACTGGCCTTCTGCTGCACCCTCACCTTTCGCGGCCGGATCTGGCCAATCGATATTGCTG
CCAGCTTCATCAATGATACAGCCTTCTCCAGATAATTCCCGTAAACGCCAGCGTCCGCTATCTCAGGTCTCGCCC
ACGATCCAGGGATCATCAAAAAGGATTGCTCCCTCGCAGCCTAAATCTCACAGATCTAAACTCGACGAGATAGAT
GCTGCACAAGAAGCCCGCCTTGCCGAGAATCAGCGCTTGTACAAGCACTGGATCGATGCGGCAGGTGACGATGCA
GATGAAATAAACGAACTTCGGGAAGAGTGTGAGGAGCAGGCGAAGTTGATTGAAACAGAGTTTCAAATGGAACGA
GACGCGGAATTGGCTCGCGCGCTCCAAGCCGACGAGGATCATAGTCAACTCCCCCGTTCCAATGAGCGTCATACA
TGGAATATTCCTGACCGCAGTCAACCGGTAAAACTCGAACATCTTTCATCAAACCCCAATCGTGCACCTCAAGCA
TATGCCCCGATAGCCCCATTCAATAAACTCAATCCATTCAATTCCGACGATGATCTTCAAGAAATCACAGCCGAT
TCATTCAAAGATCGATCCGGCAAGCAGCCAGCCCGCCCATCCAGTTCATATCCCCACCTGCCATCTCTCCCTTCG
CAGTATTCCAAATCACCGTACACTTCACAGGGACTTTATCCCTCGCGGATGCCATATCCCTCCGAGTTGACATAC
CCCTCTCAATTGCCATATCCCTCCGAGTTGACATATCCCTCCCAAATGTCATATCCTTCCCAATTGCCGTATCCT
TCGCAGCTGGCCTATCCCTCCCAATTGTCAAATTCCTCAATGCCATATTCCACATCAGCAGCTGCCTCCAGAAAC
CTTCCCTGGTCGCATGAGCATCCGTACGCTACAATGCCGGGTACATTTGAGAAGTATGACAAATTCGACAAGTTT
GACAAGGCCTTTGACCTGGTTCGCAACCAAAGCGAAATATTCGACGACGATGCTGACATAGTGTACGTCCGCATC
CTTTGAAGCAGGTAGTTCTGATTCTAACCTCAATTAATATAGGGCCTACAACGAGAAGGAGTTTCCTGAAGATAT
CAAGAACTTGCTCAGCGGTATCAAAGATATTCGAGAGGCAACTAAAGCGGACAATGATGAGACACCAAGTGCTCT
TCGAGTCACGTTGATGAAGCATCAGAAGATTGGCCTGAGATGGATGAAGGCCAAAGAAGAGAGCAACCACAAAGG
AGGAATTCTTGCAGATGACATGGGACTTGGTAAAACCATCCAAGCGATTGCACTGATGGTTGCTCGCCCATTCGA
GGATGAAGACCGACGCCCGACTTTGATTGTCGCGCCCAAGGCACTTATGGATCAATGGAGACTTGAAATCCAGCG
TCATGTCAAGCCGGGCAGGCACCAATTATCAGTCTTGATCTACCATCAACGGCGCAGGCCCTGGAAGGAGCTCAA
AAGGTATGATATCATTATCACTACGTTTGGTACAATCACTGCGCACTACAAAACATTGCTCCAGGCGGAAAAGTT
GGCAGAGGAAGGGCGGGATCCCTCGATAATCCAAGACCTCAAAAATGCGGCCGGTCCTCTCAGTCCTGCTGCCAA
GTGGCATCGCGTCATCATCGATGAAGCACAGAACATCAAGAACCCAAGTGCGAAATCGGCAATAGCATGTTGTCG
ACTCAATGCTACCTACCGCTGGTGTCTGACTGGTACGCCTATGATGAATCGTCTCGAAGATTTCCAGTCCCTTTT
GGGATTCCTCCGGATTCGGCCTTATAGCAACCCAGCAAAGTTTAAGGCGGTTAGTACTCTCTATAGTTCACAATT
GATGTATGCTTCTTTGGCTGACTGACATTTATATCTATCCAGGACTTCGTGAGACGCATTAAATCTGGTTGGGGA
GGCGAAGATGTCATGAAGCAACTACGCGTTCTAGTCAAGTCTGTCTGTCTCCGACGCACAAAATCCTCCAAGATT
GATGGCGAGCCCATCTTGCAACTCCCACCAAAGGTCACCGAGAAGGTCCATGTTGTGTTTGATGAGAGAGAAAGC
CAGGTTTATGAGGAACTCAATACGTCCACTCAAAGGCAGATCACCCGGTACCTTGACTCAGGCACGTTGGGCAGG
AACTACAGCCATGTTCTAGTTCTCCTTCTCCGTCTTCGGCAGGCATGCTGCCATCCACTTCTCATGCAGGATTTC
CGAAACGAACCCTCCCCGTCTATCCCGGGGGTGGATAAGATCGCCAACGCTAAACTTCTGACCGCTGCTGTAGTG
CAACGTATCAAAGATAATGACGGCGAAGAGGATGGCACCTGCCCTGTCTGCATGGACAGTGTCAAAAATGCGACT
ATTTACATTCCATGTGGACACCATGTGTGCTCGGAGTGCTGGATCCGCATTTCCGACTCTGCAACTGCAAACGGA
GCCATCAACCTCGAAGACGATGGTCCAGCTGTGATTAAGTGCCAGAACTGCCGAGGGCCCGTGGACCCTGCGAAA
CTCACCGACACCAATGCATTCAAGCAGGTCCACGATCCAACCTCAGTGCCCGAATTTGCCGCCGGAGGCGGTGAT
ACCAACGGGCCCAATGACGACGAAGACCCAGAAGCAACAGCGAGCAGTGAAGAGTCTGACTCCGATAGCTCTACT
GGAGAGGGCGATGCGGAATCAAAGAAGAAAACGAAGGCGAAGTCTCTAGCCCAGCTGCGCAAGGACGCTTTGAGG
AACAAGGCCGAGAAGAAGAAATACATTCGCCGCCTCGAGAAGGGCTGGTTCCCCAGCACAAAAATCACAAAGACG
CTGGAGATCCTCCAAGCCAATGAAGACCGCGGCTTAGAGGAGAAAACTATCATTTTCAGCCAGTTCACCTCCCTC
TTGGATCTTCTCGAAGTCCCCCTGGCCCGCCGCGGCTGGAACCACACCCGCTTCGACGGCAGCATGAATCTGAAG
GAGCGCAACGCCGCTGTGACGGCTTTCACCAATGATCCTGACTGCAAGATCATGCTCGTCTCCCTCAAGGCCGGC
AACTCCGGTCTGAACCTCGTCGCCGCTTCGCATGTCATCATGTTCGACCCCTTCTGGAACCCGTACATTGAAGAC
CAGGCCGTTGATCGTGCCCATCGCATCGGGCAGGTTAGAGAGGTCTTCGTTCACCGTCTGCTTATCGAGAATACT
GTTGAGGACCGCATTGTTACTCTTCAGGACCAGAAGCGTGAGCTTATCAGTGGTGCTCTCGATGAGGGCGGTACC
ATGAATGTCTCCCGACTAGATGCGAGGGAACTTGCTTATCTCTTCGTATGTTTATCCCTATTTTCCTCGTTTTCT
ACTTTGACTGGACTCTTTGCTAACTCCTTATCCGTTACACAGGGTGTGAGAGACTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail