Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5242.t1
Gene name
Locationscaffold_12:280261..282607
Strand+
Gene length (bp)2346
Transcript length (bp)2130
Coding sequence length (bp)2130
Protein length (aa) 710

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02990 EMP70 Endomembrane protein 70 3.2E-202 56 666

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 305 327 22
3 412 434 22
4 441 463 22
5 478 500 22
6 513 535 22
7 565 587 22
8 599 621 22
9 636 658 22
10 671 693 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5242.t1
MAFGQFCSRQWALWVLLLVSCTGAFYIPGYSITRYNDGDPIPLLVNKIFSDHTQLQYAYFDLPFVCPPSGKTHGG
SPFGSGQSISLNIGEVLRGDRIMTSDFEVAMGKDVECQSLCTRDVSRSNVKWARQLIKEGYVIEWIADNLPGATS
FVTVDRSRKYYASGFKLGYRDISPVTGQHRYFINNHFTIVIRWRSAPEGGKVIVGFEVYPKSITAEDRLENGCPK
AVHNSNEGLGLYIAPNLSRMEEKYSGLSYIPDDDDEDDDGATLKVPYTYSVYFREDTNVEWANRWDLYFTNQVES
SITHWLAIINSLTICTVLGVTVFVIWSRTVQGDLKGRGDGAMDDRKMKGQSRRRSGKSEKKGEGLLDDSADVERD
ADYSSDDEAVEDTSGWKLLHGDVFRIPAYSGLLAPLVGSGMQLLFMASGLLLLSCLGILNPSFRGGFVSVGMGLF
VFAGLFSGYFSGRLYKTFGGTAWRKNTLITALLFPGLAFCLVLILNLFVWAQASSTAIPFGTLIGLLALWLLIQV
PLVYIGSWVGYVRAMPWEHPLKTNAIARQVPPQPWYLRTPLGPVVTGVVPFAVLFIELLFLFKNLWQDKSGYYYV
FGFLSAVSTVLIVTVVEVTVIATYSQLCSENYHWWWQSFLTGGSSAFWIFAYCIWYYMFKLHITGFVSSLLFFSY
SFLACAVYGLLTGTVGFLAAYAFVRRVYSAIKVD*
Coding >Pro_DTO377G3_2|g5242.t1
ATGGCCTTTGGTCAATTCTGTTCCCGTCAGTGGGCACTGTGGGTGCTGCTGCTTGTGTCCTGTACCGGCGCATTC
TACATCCCTGGATACTCAATTACCCGGTATAATGATGGCGATCCGATTCCTCTTCTGGTGAACAAGATTTTCTCC
GATCACACCCAGCTGCAGTATGCGTATTTCGACCTGCCTTTCGTCTGTCCGCCGAGCGGCAAAACACATGGCGGC
TCGCCGTTTGGATCCGGCCAAAGCATCTCGCTCAATATTGGGGAGGTACTGCGTGGCGATCGAATCATGACCTCC
GACTTCGAAGTTGCGATGGGAAAGGATGTTGAGTGCCAGTCGCTCTGCACCCGTGATGTTAGTCGGTCAAATGTG
AAATGGGCCCGTCAACTCATCAAGGAGGGATATGTGATCGAATGGATTGCCGATAATCTTCCAGGAGCCACGAGC
TTTGTGACTGTGGATCGAAGCCGCAAGTATTACGCTTCCGGATTCAAGCTTGGCTATCGAGATATCTCTCCAGTC
ACCGGACAGCATCGGTACTTTATCAACAACCACTTCACGATCGTCATCCGCTGGCGGAGCGCACCGGAAGGAGGG
AAGGTGATCGTAGGCTTTGAGGTGTACCCGAAGAGTATTACTGCCGAGGACCGCCTGGAAAATGGATGCCCCAAA
GCTGTCCACAATAGCAACGAAGGACTGGGGCTGTATATCGCGCCGAATCTTTCGCGAATGGAAGAGAAATATTCC
GGACTGTCATATATCCCAGATGATGATGACGAAGATGATGACGGAGCCACACTGAAGGTTCCCTACACCTACTCT
GTCTACTTCCGAGAGGACACCAACGTCGAGTGGGCCAACCGCTGGGATTTATACTTTACCAATCAGGTTGAAAGT
TCGATAACCCATTGGCTGGCGATCATCAACTCATTGACAATTTGCACCGTACTGGGAGTGACCGTGTTCGTCATC
TGGAGCCGTACAGTGCAAGGCGATCTCAAGGGTCGCGGCGATGGTGCGATGGACGATCGGAAGATGAAGGGCCAA
TCTCGACGCCGGAGTGGCAAGTCTGAGAAGAAAGGCGAGGGGCTTCTGGATGATAGCGCAGATGTCGAGCGCGAT
GCAGACTACTCCTCAGACGATGAGGCTGTCGAAGATACAAGTGGTTGGAAGCTTCTTCATGGGGATGTGTTCCGT
ATCCCCGCCTATAGTGGTCTTCTTGCTCCCTTGGTTGGATCAGGAATGCAGTTGTTATTCATGGCTTCAGGCTTG
CTCCTGCTTAGCTGCCTCGGAATCTTGAACCCAAGCTTCCGTGGTGGCTTCGTCAGCGTTGGCATGGGCCTGTTC
GTCTTTGCGGGCCTTTTCTCAGGTTACTTCTCTGGAAGACTTTACAAGACCTTTGGCGGAACTGCTTGGCGCAAG
AACACGCTCATCACCGCTTTGCTTTTCCCTGGTCTGGCATTCTGCCTCGTGTTGATTCTGAACTTGTTTGTCTGG
GCGCAAGCATCTAGTACGGCAATTCCTTTCGGCACTCTTATTGGTCTCCTTGCACTTTGGCTGCTCATCCAAGTT
CCGCTGGTATACATCGGCAGCTGGGTCGGCTATGTGCGTGCGATGCCATGGGAGCACCCTCTGAAGACGAATGCG
ATTGCCCGCCAAGTCCCACCCCAGCCCTGGTATCTCCGCACCCCTCTCGGGCCTGTGGTAACTGGCGTCGTTCCA
TTTGCAGTTCTTTTTATTGAGCTGCTATTCCTTTTCAAGAACCTATGGCAGGACAAGTCTGGTTATTACTATGTC
TTCGGCTTCCTGAGTGCTGTCTCAACCGTGCTGATTGTCACGGTCGTTGAGGTGACCGTGATCGCAACATACAGC
CAGCTTTGCTCCGAGAATTATCATTGGTGGTGGCAGAGTTTCCTCACCGGCGGAAGCAGCGCTTTTTGGATTTTT
GCCTACTGCATCTGGTATTACATGTTCAAGCTCCACATCACCGGGTTCGTGTCAAGCTTGCTGTTCTTCAGCTAC
AGCTTCCTCGCTTGTGCTGTGTATGGCCTGTTAACTGGAACCGTTGGTTTCTTGGCCGCTTATGCGTTCGTCCGG
CGTGTTTATAGTGCTATCAAGGTCGACTAA
Transcript >Pro_DTO377G3_2|g5242.t1
ATGGCCTTTGGTCAATTCTGTTCCCGTCAGTGGGCACTGTGGGTGCTGCTGCTTGTGTCCTGTACCGGCGCATTC
TACATCCCTGGATACTCAATTACCCGGTATAATGATGGCGATCCGATTCCTCTTCTGGTGAACAAGATTTTCTCC
GATCACACCCAGCTGCAGTATGCGTATTTCGACCTGCCTTTCGTCTGTCCGCCGAGCGGCAAAACACATGGCGGC
TCGCCGTTTGGATCCGGCCAAAGCATCTCGCTCAATATTGGGGAGGTACTGCGTGGCGATCGAATCATGACCTCC
GACTTCGAAGTTGCGATGGGAAAGGATGTTGAGTGCCAGTCGCTCTGCACCCGTGATGTTAGTCGGTCAAATGTG
AAATGGGCCCGTCAACTCATCAAGGAGGGATATGTGATCGAATGGATTGCCGATAATCTTCCAGGAGCCACGAGC
TTTGTGACTGTGGATCGAAGCCGCAAGTATTACGCTTCCGGATTCAAGCTTGGCTATCGAGATATCTCTCCAGTC
ACCGGACAGCATCGGTACTTTATCAACAACCACTTCACGATCGTCATCCGCTGGCGGAGCGCACCGGAAGGAGGG
AAGGTGATCGTAGGCTTTGAGGTGTACCCGAAGAGTATTACTGCCGAGGACCGCCTGGAAAATGGATGCCCCAAA
GCTGTCCACAATAGCAACGAAGGACTGGGGCTGTATATCGCGCCGAATCTTTCGCGAATGGAAGAGAAATATTCC
GGACTGTCATATATCCCAGATGATGATGACGAAGATGATGACGGAGCCACACTGAAGGTTCCCTACACCTACTCT
GTCTACTTCCGAGAGGACACCAACGTCGAGTGGGCCAACCGCTGGGATTTATACTTTACCAATCAGGTTGAAAGT
TCGATAACCCATTGGCTGGCGATCATCAACTCATTGACAATTTGCACCGTACTGGGAGTGACCGTGTTCGTCATC
TGGAGCCGTACAGTGCAAGGCGATCTCAAGGGTCGCGGCGATGGTGCGATGGACGATCGGAAGATGAAGGGCCAA
TCTCGACGCCGGAGTGGCAAGTCTGAGAAGAAAGGCGAGGGGCTTCTGGATGATAGCGCAGATGTCGAGCGCGAT
GCAGACTACTCCTCAGACGATGAGGCTGTCGAAGATACAAGTGGTTGGAAGCTTCTTCATGGGGATGTGTTCCGT
ATCCCCGCCTATAGTGGTCTTCTTGCTCCCTTGGTTGGATCAGGAATGCAGTTGTTATTCATGGCTTCAGGCTTG
CTCCTGCTTAGCTGCCTCGGAATCTTGAACCCAAGCTTCCGTGGTGGCTTCGTCAGCGTTGGCATGGGCCTGTTC
GTCTTTGCGGGCCTTTTCTCAGGTTACTTCTCTGGAAGACTTTACAAGACCTTTGGCGGAACTGCTTGGCGCAAG
AACACGCTCATCACCGCTTTGCTTTTCCCTGGTCTGGCATTCTGCCTCGTGTTGATTCTGAACTTGTTTGTCTGG
GCGCAAGCATCTAGTACGGCAATTCCTTTCGGCACTCTTATTGGTCTCCTTGCACTTTGGCTGCTCATCCAAGTT
CCGCTGGTATACATCGGCAGCTGGGTCGGCTATGTGCGTGCGATGCCATGGGAGCACCCTCTGAAGACGAATGCG
ATTGCCCGCCAAGTCCCACCCCAGCCCTGGTATCTCCGCACCCCTCTCGGGCCTGTGGTAACTGGCGTCGTTCCA
TTTGCAGTTCTTTTTATTGAGCTGCTATTCCTTTTCAAGAACCTATGGCAGGACAAGTCTGGTTATTACTATGTC
TTCGGCTTCCTGAGTGCTGTCTCAACCGTGCTGATTGTCACGGTCGTTGAGGTGACCGTGATCGCAACATACAGC
CAGCTTTGCTCCGAGAATTATCATTGGTGGTGGCAGAGTTTCCTCACCGGCGGAAGCAGCGCTTTTTGGATTTTT
GCCTACTGCATCTGGTATTACATGTTCAAGCTCCACATCACCGGGTTCGTGTCAAGCTTGCTGTTCTTCAGCTAC
AGCTTCCTCGCTTGTGCTGTGTATGGCCTGTTAACTGGAACCGTTGGTTTCTTGGCCGCTTATGCGTTCGTCCGG
CGTGTTTATAGTGCTATCAAGGTCGACTAA
Gene >Pro_DTO377G3_2|g5242.t1
ATGGCCTTTGGTCAATTCTGTTCCCGTCAGTGGGCACTGTGGGTGCTGCTGCTTGTGTCCTGTACCGGCGCATTC
TACATCCCTGGTAAGCACCGTGGCGCATATTGGTTGGACTAAGCATATGATACTCATACTTTTCCTCCCACCAGG
ATACTCAATTACCCGGTATAATGATGGCGATCCGATTCCTCTTCTGGTGAACAAGATTTTCTCCGATCACACCCA
GCTGCAGTATGCGTATTTCGACCTGCCTTTCGTCTGTCCGCCGAGCGGCAAAACACATGGCGGCTCGCCGTTTGG
ATCCGGCCAAAGCATCTCGCTCAATATTGGGGAGGTACTGCGTGGCGATCGAATCATGACCTCCGACTTCGAAGT
TGCGATGGGAAAGGATGTTGAGTGCCAGTCGCTCTGCACCCGTGATGTTAGTCGGTCAAATGTGAAATGGGCCCG
TCAACTCATCAAGGAGGGATATGTGATCGAATGGATTGCCGATAATCTTCCAGGAGCCACGAGCTTTGTGACTGT
GGATCGAAGCCGCAAGTATTACGCTTCCGGATTCAAGCTTGGCTATCGAGATATCTCTCCAGTCACCGGACAGCA
TCGGTACTTTATCAACAACCACTTCACGATCGTCATCCGCTGGCGGAGCGCACCGGAAGGAGGGAAGGTGATCGT
AGGCTTTGAGGTGTACCCGAAGAGTATTACTGCCGAGGACCGCCTGGAAAATGGATGCCCCAAAGCTGTCCACAA
TAGCAACGAAGGACTGGGGCTGTATATCGCGCCGAATCTTTCGCGAATGGAAGAGAAATATTCCGGACTGTCATA
TATCCCAGATGATGATGACGAAGATGATGACGGAGCCACACTGAAGGTTCCCTACACCTACTCTGTCTACTTCCG
AGAGGACACCAACGTCGAGTGGGCCAACCGCTGGGATTTATACTTTACCAATCAGGTTGAAAGTTCGATAACCCA
TTGGCTGGCGATCATCAACTCATTGACAATTTGCACCGTACTGGGAGTGACCGTGTTCGTCATCTGGAGCCGTAC
AGTGCAAGGCGATCTCAAGGGTCGCGGCGATGGTGCGATGGACGATCGGAAGATGAAGGGCCAATCTCGACGCCG
GAGTGGCAAGTCTGAGAAGAAAGGCGAGGGGCTTCTGGATGATAGCGCAGATGTCGAGCGCGATGCAGACTACTC
CTCAGACGATGAGGCTGTCGAAGATACAAGTGGTTGGAAGCTTCTTCATGGGGATGTGTTCCGTATCCCCGCCTA
TAGTGGTCTTCTTGCTCCCTTGGTTGGATCAGGAATGCAGTTGTTATTCATGGCTTCAGGCTTGCTCCTGCTTAG
CTGCCTCGGAATCTTGAACCCAAGCTTCCGTGGTGGCTTCGTCAGCGTTGGCATGGGCCTGTTCGTCTTTGCGGG
CCTTTTCTCAGGTTACTTCTCTGGAAGACTTTACAAGACCTTTGGCGGAACTGCTTGGCGCAAGAACACGCTCAT
CGTGCGTATCCTACTCCAATTATTCATGTGCTATGCTAATCTATGGTTCTAGACCGCTTTGCTTTTCCCTGGTCT
GGCATTCTGCCTCGTGTTGATTCTGAACTTGTTTGTCTGGGCGCAAGCATCTAGTACGGCAATTCCTTTCGGCAC
TCTTATTGGTCTCCTTGCACTTTGGCTGCTCATCCAAGTTCCGCTGGTATACATCGGCAGCTGGGTCGGCTATGT
GCGTGCGATGCCATGGGAGCACCCTCTGAAGACGAATGCGATTGCCCGCCAAGTCCCACCCCAGCCCTGGTATCT
CCGCACCCCTCTCGGGCCTGTGGTAACTGGCGTCGTTCCATTTGCAGTTCTTTTTATTGAGCTGCTATTCCTTTT
CAAGAACCTATGGCAGGACAAGTCTGGTTATTACTATGTCTTCGGCTTCCTGAGTGCTGTCTCAACCGTGCTGAT
TGTCACGGTCGTTGAGGTGACCGTGATCGCAACATACAGCCAGCTTTGCTCCGAGGTAAGACTGTTCTTGGCTTG
GTTTCTGGATCATACTGACTCCCTTAGAATTATCATTGGTGGTGGCAGAGTTTCCTCACCGGCGGAAGCAGCGCT
TTTTGGATTTTTGCCTACTGCATCTGGTATTACATGTTCAAGCTCCACATCACCGGGTTCGTGTCAAGCTTGCTG
TTCTTCAGCTACAGCTTCCTCGCTTGTGCTGTGTATGGCCTGTTAACTGGAACCGTTGGTTTCTTGGCCGCTTAT
GCGTTCGTCCGGCGTGTTTATAGGTAAGGTCATTCCATTGAATCTGCTAGGCAAGAGGCTAATCGTGAGAATTGC
AGTGCTATCAAGGTCGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail