Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5241.t1
Gene name
Locationscaffold_12:277689..279167
Strand+
Gene length (bp)1478
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00240 ubiquitin Ubiquitin family 8.9E-20 16 86
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 8.1E-08 14 84
PF00627 UBA UBA/TS-N domain 1.2E-07 426 462
PF13881 Rad60-SLD_2 Ubiquitin-2 like Rad60 SUMO-like 9.7E-05 32 101

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 89.88 55.02 124.73
5d_25C Five days - 25 degrees Celsius 94.15 57.70 130.61
7d_25C Seven days - 25 degrees Celsius 84.40 51.41 117.38
10d_25C Ten days - 25 degrees Celsius 105.10 64.36 145.84
7d_15C Seven days - 15 degrees Celsius 103.62 63.28 143.96
7d_30C Seven days - 30 degrees Celsius 97.48 59.95 135.02

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.880133 no
3d_25C 7d_25C 0.834648 no
3d_25C 7d_15C 0.587437 no
3d_25C 7d_30C 0.778253 no
3d_25C 10d_25C 0.527900 no
5d_25C 7d_25C 0.696129 no
5d_25C 7d_15C 0.740483 no
5d_25C 7d_30C 0.918445 no
5d_25C 10d_25C 0.688080 no
7d_25C 7d_15C 0.409805 no
7d_25C 7d_30C 0.593806 no
7d_25C 10d_25C 0.357001 no
7d_15C 7d_30C 0.846261 no
7d_15C 10d_25C 0.968401 no
7d_30C 10d_25C 0.794959 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5241.t1
MADETATTEQPPITFTVKSSTDAKYTLTLPLTTLVSDLKQKLSTPENADTPAERQRLIYSGRVLKDTETLETYKI
KDGHTIHLVKSAASNQQRQNTAAQPNSASAAGGATPAIAGVPTNLAAGTGNNPLAGLTGARYAGFAQLPGAGLFG
PDGGMGPPPDTESMLNMLENPQFQSTINEALQNPAMIDMMIQQNPMLRDMGPGVRQMMESPEFRRMLTDPSSIRQ
MMQMQRAMGMGGGGLGGGDNAFPAPGVTNTTAEGAPGSEQQNAQINPFGQAAQNPLGNANPFGALFGANPFATPA
QPSATPGTTSPGGAQGADSTDRSTSAEGQTPQAAPNPFAALLNPAMFANAGQAGQGGANPFNPQQNPFLRDPALL
AQMMQGMGGQDAQGGAAGANPLAALLGSGGFGGGLGAPQPPADTRAPEDRYADQLRQLNDMGFFEFERNIEALRR
TGGSVQGAVEYLLSHP*
Coding >Pro_DTO377G3_2|g5241.t1
ATGGCCGACGAGACAGCTACCACAGAGCAGCCCCCCATCACCTTCACTGTCAAGTCATCCACCGATGCCAAATAC
ACTCTCACCCTCCCACTCACTACTCTGGTGTCAGATCTCAAGCAGAAGCTCTCAACCCCAGAAAATGCCGATACC
CCCGCAGAACGCCAGCGATTGATCTACTCGGGTAGGGTTTTGAAGGACACTGAGACACTGGAGACCTACAAGATC
AAGGATGGCCATACTATTCACCTCGTAAAGAGTGCTGCGAGCAACCAGCAGCGCCAAAACACAGCTGCTCAGCCC
AACTCAGCTTCTGCGGCCGGTGGAGCAACTCCAGCGATAGCTGGTGTCCCAACCAATCTAGCCGCTGGTACTGGT
AACAACCCACTTGCTGGATTGACTGGTGCGAGATATGCTGGATTCGCACAACTTCCCGGCGCGGGCCTTTTCGGC
CCTGATGGCGGGATGGGTCCTCCCCCAGATACTGAGTCGATGCTCAACATGCTCGAGAATCCTCAATTCCAATCG
ACCATCAACGAAGCTCTGCAAAACCCCGCTATGATCGACATGATGATCCAGCAGAATCCCATGCTTCGCGACATG
GGACCCGGAGTCCGGCAGATGATGGAAAGCCCAGAGTTCCGCCGCATGTTGACCGATCCGAGCTCGATTCGACAG
ATGATGCAAATGCAACGAGCTATGGGAATGGGTGGCGGTGGACTTGGTGGCGGTGATAATGCATTCCCCGCCCCG
GGGGTAACAAACACGACCGCTGAGGGAGCCCCAGGTTCAGAGCAACAGAACGCGCAAATAAATCCATTTGGGCAG
GCGGCTCAGAATCCTCTTGGAAACGCCAACCCTTTCGGTGCCCTCTTTGGAGCTAATCCGTTCGCAACCCCAGCC
CAGCCTTCTGCCACCCCAGGCACCACTTCACCCGGCGGTGCACAAGGTGCCGATTCTACGGACCGATCAACATCT
GCTGAGGGGCAGACTCCTCAGGCTGCTCCGAATCCCTTCGCAGCTCTTCTGAACCCGGCTATGTTCGCCAACGCT
GGACAAGCTGGCCAGGGCGGCGCGAACCCGTTCAATCCTCAGCAAAATCCGTTCCTACGTGACCCGGCGCTACTT
GCCCAAATGATGCAGGGAATGGGTGGACAGGACGCACAAGGTGGGGCTGCCGGTGCAAACCCTCTGGCTGCTCTA
CTTGGCAGTGGTGGTTTCGGAGGTGGTCTCGGAGCACCACAGCCGCCTGCAGACACCCGCGCCCCGGAGGATAGA
TATGCCGATCAGTTGCGGCAGTTGAATGATATGGGATTCTTTGAGTTCGAGCGGAACATTGAAGCCCTGCGTCGC
ACAGGTGGCAGCGTTCAGGGAGCGGTGGAGTACCTCCTCAGCCACCCATGA
Transcript >Pro_DTO377G3_2|g5241.t1
ATGGCCGACGAGACAGCTACCACAGAGCAGCCCCCCATCACCTTCACTGTCAAGTCATCCACCGATGCCAAATAC
ACTCTCACCCTCCCACTCACTACTCTGGTGTCAGATCTCAAGCAGAAGCTCTCAACCCCAGAAAATGCCGATACC
CCCGCAGAACGCCAGCGATTGATCTACTCGGGTAGGGTTTTGAAGGACACTGAGACACTGGAGACCTACAAGATC
AAGGATGGCCATACTATTCACCTCGTAAAGAGTGCTGCGAGCAACCAGCAGCGCCAAAACACAGCTGCTCAGCCC
AACTCAGCTTCTGCGGCCGGTGGAGCAACTCCAGCGATAGCTGGTGTCCCAACCAATCTAGCCGCTGGTACTGGT
AACAACCCACTTGCTGGATTGACTGGTGCGAGATATGCTGGATTCGCACAACTTCCCGGCGCGGGCCTTTTCGGC
CCTGATGGCGGGATGGGTCCTCCCCCAGATACTGAGTCGATGCTCAACATGCTCGAGAATCCTCAATTCCAATCG
ACCATCAACGAAGCTCTGCAAAACCCCGCTATGATCGACATGATGATCCAGCAGAATCCCATGCTTCGCGACATG
GGACCCGGAGTCCGGCAGATGATGGAAAGCCCAGAGTTCCGCCGCATGTTGACCGATCCGAGCTCGATTCGACAG
ATGATGCAAATGCAACGAGCTATGGGAATGGGTGGCGGTGGACTTGGTGGCGGTGATAATGCATTCCCCGCCCCG
GGGGTAACAAACACGACCGCTGAGGGAGCCCCAGGTTCAGAGCAACAGAACGCGCAAATAAATCCATTTGGGCAG
GCGGCTCAGAATCCTCTTGGAAACGCCAACCCTTTCGGTGCCCTCTTTGGAGCTAATCCGTTCGCAACCCCAGCC
CAGCCTTCTGCCACCCCAGGCACCACTTCACCCGGCGGTGCACAAGGTGCCGATTCTACGGACCGATCAACATCT
GCTGAGGGGCAGACTCCTCAGGCTGCTCCGAATCCCTTCGCAGCTCTTCTGAACCCGGCTATGTTCGCCAACGCT
GGACAAGCTGGCCAGGGCGGCGCGAACCCGTTCAATCCTCAGCAAAATCCGTTCCTACGTGACCCGGCGCTACTT
GCCCAAATGATGCAGGGAATGGGTGGACAGGACGCACAAGGTGGGGCTGCCGGTGCAAACCCTCTGGCTGCTCTA
CTTGGCAGTGGTGGTTTCGGAGGTGGTCTCGGAGCACCACAGCCGCCTGCAGACACCCGCGCCCCGGAGGATAGA
TATGCCGATCAGTTGCGGCAGTTGAATGATATGGGATTCTTTGAGTTCGAGCGGAACATTGAAGCCCTGCGTCGC
ACAGGTGGCAGCGTTCAGGGAGCGGTGGAGTACCTCCTCAGCCACCCATGA
Gene >Pro_DTO377G3_2|g5241.t1
ATGGCCGACGAGACAGCTACCACAGAGCAGCCCCCCATCACCTTCACTGTCAAGTCATCCACCGATGCCAAATAC
ACTCTCACCCTCCCACTCACTACTCTGGTGTCAGATCTCAAGCAGAAGCTCTCAACCCCAGAAAATGCCGATACC
CCCGCAGAACGCCAGCGATTGATCTACTCGGGTAGGGTTTTGAAGGACACTGAGACACTGGAGACCTACAAGATC
AAGGATGGCCATACTATTCACCTCGTAAAGAGTGCTGCGAGCAACCAGCAGCGCCAAAACACAGCTGCTCAGCCC
AACTCAGCTTCTGCGGCCGGTGGAGCAACTCCAGCGATAGCTGGTGTCCCAACCAATCTAGCCGCTGGTACTGGT
AACAACCCACTTGCTGGATTGACTGGTGCGAGATATGCTGGATTCGCACAACTTCCCGGCGCGGGCCTTTTCGGC
CCTGATGGCGGGGTAAGTGAGCTATTATGGCGGATGGAAGCTATTCAGCAATGCCTCCAACAGATAGCTAACATT
CTTTGGCTACTTAGATGGGTCCTCCCCCAGATACTGAGTCGATGCTCAACATGCTCGAGAATCCTCAATTCCAAT
CGACCATCAACGAAGCTCTGCAAAACCCCGCTATGATCGACATGATGATCCAGCAGAATCCCATGCTTCGCGACA
TGGGACCCGGAGTCCGGCAGATGATGGAAAGCCCAGAGTTCCGCCGCATGTTGACCGATCCGAGCTCGATTCGAC
AGATGATGCAAATGCAACGAGCTATGGGAATGGGTGGCGGTGGACTTGGTGGCGGTGATAATGCATTCCCCGCCC
CGGGGGTAACAAACACGACCGCTGAGGGAGCCCCAGGTTCAGAGCAACAGAACGCGCAAATAAATCCATTTGGGC
AGGCGGCTCAGAATCCTCTTGGAAACGCCAACCCTTTCGGTGCCCTCTTTGGAGCTAATCCGTTCGCAACCCCAG
CCCAGCCTTCTGCCACCCCAGGCACCACTTCACCCGGCGGTGCACAAGGTGCCGATTCTACGGACCGATCAACAT
CTGCTGAGGGGCAGACTCCTCAGGCTGCTCCGAATCCCTTCGCAGCTCTTCTGAACCCGGCTATGTTCGCCAACG
CTGGACAAGCTGGCCAGGGCGGCGCGAACCCGTTCAATCCTCAGCAAAATCCGTTCCTACGTGACCCGGCGCTAC
TTGCCCAAATGATGCAGGGAATGGGTGGACAGGACGCACAAGGTGGGGCTGCCGGTGCAAACCCTCTGGCTGCTC
TACTTGGCAGTGGTGGTTTCGGAGGTGGTCTCGGAGCACCACAGCCGCCTGCAGACACCCGCGCCCCGGAGGATA
GATATGCCGATCAGTTGCGGCAGTTGAATGATATGGGATTCTTTGAGTTCGAGCGGAACATTGAAGCCCTGCGTC
GCACAGGTGGCAGCGTTCAGGGAGCGGTGGAGTACCTCCTCAGCCACCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail