Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5230.t1
Gene name
Locationscaffold_12:244437..245506
Strand+
Gene length (bp)1069
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09377 SBDS_C SBDS protein C-terminal domain 3.7E-42 108 315
PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein 2.6E-30 14 102

GO

GO Term Description Terminal node
GO:0042254 ribosome biogenesis Yes
GO:0008150 biological_process No
GO:0071840 cellular component organization or biogenesis No
GO:0044085 cellular component biogenesis No
GO:0022613 ribonucleoprotein complex biogenesis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5230.t1
MPINQPSNQIKFTNVSVVRLKKGKKRFELACYKNKLLEYRSGAEKDLDNVLQVPTVFLSVSKAQTTPTAELAKAF
GTGTPREEILQEILRKGEVQVGERERKDILERVEKEVLDIVSGRLVDPSTKRVYTSGMIHKALDQLTSASGQQQA
HSSGEVNGDGEEKPSQPKKPLWTGVSANRSAKSQALDAMKALIAWQPIPVMRARMRLRVTCPVSLLKQSVKAAPG
AASNKEKEAPSGGSKNNKKGNKGSKKSKKDDSDIEAGQSDVEAPKAPGTVKDKIMAFIESVESQEVIGGDEWEIV
GFAEPGAFKGLNELVSNETRGRGRVEVLDMSVTHED*
Coding >Pro_DTO377G3_2|g5230.t1
ATGCCTATCAACCAACCCTCCAACCAGATCAAATTCACCAATGTATCGGTGGTCCGACTAAAGAAGGGCAAGAAG
CGCTTTGAACTCGCCTGTTACAAGAACAAACTGCTGGAATACCGATCCGGCGCCGAAAAAGATCTCGACAATGTC
CTCCAAGTCCCAACCGTGTTCCTCTCCGTCTCCAAAGCACAAACAACCCCAACAGCAGAGCTAGCAAAGGCCTTC
GGGACCGGTACCCCACGAGAGGAAATCCTCCAAGAGATCCTCCGTAAAGGCGAAGTGCAAGTCGGCGAGCGTGAG
CGCAAAGACATCCTCGAGCGAGTGGAGAAGGAAGTGCTGGATATCGTGTCAGGTCGACTAGTCGACCCCTCAACC
AAGCGCGTGTACACCTCTGGAATGATCCACAAAGCGTTGGATCAATTAACCTCGGCCAGCGGACAACAACAGGCA
CATTCGAGCGGGGAGGTGAATGGAGATGGCGAGGAGAAACCCTCTCAGCCGAAGAAGCCGCTCTGGACGGGAGTT
TCGGCGAACCGCTCGGCGAAGAGTCAAGCGTTGGATGCCATGAAGGCTCTCATCGCCTGGCAGCCGATCCCCGTT
ATGCGAGCCCGCATGCGTCTTCGTGTGACATGTCCAGTGTCCCTGCTGAAGCAGTCTGTCAAGGCTGCCCCAGGT
GCAGCATCGAATAAGGAGAAGGAAGCCCCATCTGGTGGCTCAAAGAACAACAAGAAAGGGAATAAGGGATCGAAG
AAATCTAAGAAGGACGATTCAGATATTGAGGCTGGTCAGTCTGATGTGGAAGCACCCAAGGCCCCGGGCACCGTC
AAGGACAAAATCATGGCGTTCATCGAATCAGTTGAATCGCAAGAAGTCATTGGCGGGGATGAGTGGGAAATTGTT
GGGTTTGCTGAACCCGGTGCGTTCAAGGGATTGAACGAGTTGGTGAGCAATGAGACCCGCGGAAGAGGCCGGGTT
GAGGTTCTGGACATGTCGGTCACACATGAGGATTGA
Transcript >Pro_DTO377G3_2|g5230.t1
ATGCCTATCAACCAACCCTCCAACCAGATCAAATTCACCAATGTATCGGTGGTCCGACTAAAGAAGGGCAAGAAG
CGCTTTGAACTCGCCTGTTACAAGAACAAACTGCTGGAATACCGATCCGGCGCCGAAAAAGATCTCGACAATGTC
CTCCAAGTCCCAACCGTGTTCCTCTCCGTCTCCAAAGCACAAACAACCCCAACAGCAGAGCTAGCAAAGGCCTTC
GGGACCGGTACCCCACGAGAGGAAATCCTCCAAGAGATCCTCCGTAAAGGCGAAGTGCAAGTCGGCGAGCGTGAG
CGCAAAGACATCCTCGAGCGAGTGGAGAAGGAAGTGCTGGATATCGTGTCAGGTCGACTAGTCGACCCCTCAACC
AAGCGCGTGTACACCTCTGGAATGATCCACAAAGCGTTGGATCAATTAACCTCGGCCAGCGGACAACAACAGGCA
CATTCGAGCGGGGAGGTGAATGGAGATGGCGAGGAGAAACCCTCTCAGCCGAAGAAGCCGCTCTGGACGGGAGTT
TCGGCGAACCGCTCGGCGAAGAGTCAAGCGTTGGATGCCATGAAGGCTCTCATCGCCTGGCAGCCGATCCCCGTT
ATGCGAGCCCGCATGCGTCTTCGTGTGACATGTCCAGTGTCCCTGCTGAAGCAGTCTGTCAAGGCTGCCCCAGGT
GCAGCATCGAATAAGGAGAAGGAAGCCCCATCTGGTGGCTCAAAGAACAACAAGAAAGGGAATAAGGGATCGAAG
AAATCTAAGAAGGACGATTCAGATATTGAGGCTGGTCAGTCTGATGTGGAAGCACCCAAGGCCCCGGGCACCGTC
AAGGACAAAATCATGGCGTTCATCGAATCAGTTGAATCGCAAGAAGTCATTGGCGGGGATGAGTGGGAAATTGTT
GGGTTTGCTGAACCCGGTGCGTTCAAGGGATTGAACGAGTTGGTGAGCAATGAGACCCGCGGAAGAGGCCGGGTT
GAGGTTCTGGACATGTCGGTCACACATGAGGATTGA
Gene >Pro_DTO377G3_2|g5230.t1
ATGCCTATCAACCAACCCTCCAACCAGATCAAATTCACCAATGTATCGGTGGTCCGACTAAAGAAGGGTACACTT
CTATCTTACCTATGTTCCTTGGACGTTTCTAACCTTTTATCCTAATCCAGGCAAGAAGCGCTTTGAACTCGCCTG
TTACAAGAACAAACTGCTGGAATACCGATCCGGCGCCGAAAAAGATCTCGACAATGTCCTCCAAGTCCCAACCGT
GTTCCTCTCCGTCTCCAAAGCACAAACAACCCCAACAGCAGAGCTAGCAAAGGCCTTCGGGACCGGTACCCCACG
AGAGGAAATCCTCCAAGAGATCCTCCGTAAAGGCGAAGTGCAAGTCGGCGAGCGTGAGCGCAAAGACATCCTCGA
GCGAGTGGAGAAGGAAGTGCTGGATATCGTGTCAGGTCGACTAGTCGACCCCTCAACCAAGCGCGTGTACACCTC
TGGAATGATCCACAAAGCGTTGGATCAATTAACCTCGGCCAGCGGACAACAACAGGCACATTCGAGCGGGGAGGT
GAATGGAGATGGCGAGGAGAAACCCTCTCAGCCGAAGAAGCCGCTCTGGACGGGAGTTTCGGCGAACCGCTCGGC
GAAGAGTCAAGCGTTGGATGCCATGAAGGCTCTCATCGCCTGGCAGCCGATCCCCGTTATGCGAGCCCGCATGCG
TCTTCGTGTGACATGTCCAGTGTCCCTGCTGAAGCAGTCTGTCAAGGCTGCCCCAGGTGCAGCATCGAATAAGGA
GAAGGAAGCCCCATCTGGTGGCTCAAAGAACAACAAGAAAGGGAATAAGGGATCGAAGAAATCTAAGAAGGACGA
TTCAGATATTGAGGCTGGTCAGTCTGATGTGGAAGCACCCAAGGCCCCGGGCACCGTCAAGGACAAAATCATGGC
GTTCATCGAATCAGTTGAATCGCAAGAAGTCATTGGCGGGGATGAGTGGGAAATTGTTGGGTTTGCTGAACCCGG
TGCGTTCAAGGGATTGAACGAGTTGGTGAGCAATGAGACCCGCGGAAGAGGCCGGGTTGAGGTTCTGGACATGTC
GGTCACACATGAGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail