Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5222.t1
Gene name
Locationscaffold_12:227234..228750
Strand-
Gene length (bp)1516
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10 3.0E-101 26 336
PF00734 CBM_1 Fungal cellulose binding domain 3.8E-12 396 423

GO

GO Term Description Terminal node
GO:0030248 cellulose binding Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005576 extracellular region Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0030246 carbohydrate binding No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0030247 polysaccharide binding No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 29.20 15.44 42.97
5d_25C Five days - 25 degrees Celsius 20.47 9.73 31.20
7d_25C Seven days - 25 degrees Celsius 15.61 6.96 24.26
10d_25C Ten days - 25 degrees Celsius 11.19 4.55 17.83
7d_15C Seven days - 15 degrees Celsius 17.53 7.78 27.29
7d_30C Seven days - 30 degrees Celsius 26.55 13.18 39.93

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.221214 no
3d_25C 7d_25C 0.024657 yes
3d_25C 7d_15C 0.074263 no
3d_25C 7d_30C 0.802993 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.419493 no
5d_25C 7d_15C 0.684778 no
5d_25C 7d_30C 0.414269 no
5d_25C 10d_25C 0.035668 yes
7d_25C 7d_15C 0.785241 no
7d_25C 7d_30C 0.069586 no
7d_25C 10d_25C 0.340824 no
7d_15C 7d_30C 0.176783 no
7d_15C 10d_25C 0.170903 no
7d_30C 10d_25C 0.001804 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5222.t1
MVHFSTIALALASVLPQLTNASGLNTAAVAKGKLYFGSATDNSELTDTAYLAQLSNTDDFGQITPGNAQKWDATE
PSQNTFSYTKGDVIANLAATNGQKLRCHTLVWYSQLPSWVSSGSWTNATLLAAMKNHITNVVTHYKGKCYAWDVA
NEALNEDGTYRDNVFYQYIGEAYLPIAFATAAAADPDAKLYYNDYNIESAGSKATGAQRIVKLVQQYGAKIDGVG
LQAHFIVGSTPSQSAQTTNLAAFTALGVEVAYTELDIRMTLPSTSALLAQQSTDYQNTVAACVANAKCVGVTIWD
YTDKYSWVPSTFSGQGAACPWDANLVKKPAYDGILAALGGTASGTSTSSTATVTSTTTSATTTTTSATTTTTSAT
TTTTSATTTTTSSGSTTGVPLYGQCGGLGWTGSTTCTSGTCKYSNDWYSQCL*
Coding >Pro_DTO377G3_2|g5222.t1
ATGGTTCACTTCTCCACTATTGCCCTGGCACTGGCCAGTGTTCTTCCTCAGCTGACCAATGCATCCGGATTGAAC
ACCGCTGCTGTCGCAAAGGGAAAGCTATACTTCGGATCAGCTACTGATAACTCCGAGTTGACGGATACCGCATAC
CTTGCCCAGCTGAGCAACACAGACGACTTTGGACAGATTACACCCGGTAATGCGCAGAAGTGGGATGCAACCGAA
CCGTCTCAGAACACCTTTTCCTATACCAAAGGAGATGTCATTGCCAACCTCGCTGCTACGAATGGCCAAAAGCTG
CGATGCCATACTCTAGTTTGGTATAGCCAGTTGCCCAGCTGGGTCTCAAGCGGCTCCTGGACGAACGCGACTCTG
CTTGCCGCCATGAAGAACCACATCACCAACGTGGTGACTCACTACAAAGGCAAATGCTATGCTTGGGATGTTGCC
AACGAAGCTCTCAACGAGGACGGCACCTACCGTGACAACGTCTTCTACCAATACATCGGCGAGGCATACCTTCCC
ATCGCATTCGCTACAGCAGCCGCCGCAGACCCAGACGCCAAGCTCTACTACAACGACTACAACATCGAATCCGCC
GGGTCCAAGGCAACAGGTGCCCAGAGAATCGTCAAGCTGGTACAGCAGTACGGCGCCAAGATTGACGGTGTCGGT
CTACAAGCACATTTTATCGTCGGAAGTACCCCTAGCCAGAGCGCGCAGACTACCAATCTGGCCGCGTTCACGGCC
CTGGGCGTCGAAGTTGCCTATACTGAGCTTGATATCCGGATGACTCTCCCGTCGACTTCGGCCCTGCTTGCGCAG
CAGTCGACCGATTACCAGAACACCGTTGCGGCTTGTGTGGCAAATGCTAAGTGTGTGGGCGTTACTATTTGGGAC
TACACGGACAAGTACTCGTGGGTTCCTAGTACATTCTCTGGTCAGGGTGCTGCGTGTCCTTGGGATGCGAATCTG
GTGAAGAAGCCGGCTTATGATGGTATCTTGGCTGCTTTGGGTGGTACAGCTTCTGGTACTTCCACTTCCTCTACG
GCTACCGTTACCAGCACGACTACCTCTGCTACCACCACGACTACCTCTGCTACCACCACGACTACCTCTGCTACC
ACCACGACTACCTCTGCTACCACCACGACTACCAGCTCTGGTAGCACTACTGGTGTCCCTCTCTATGGTCAGTGT
GGTGGGTTGGGCTGGACTGGAAGCACAACTTGCACAAGTGGAACCTGTAAATACTCCAATGACTGGTACTCGCAG
TGCCTATAG
Transcript >Pro_DTO377G3_2|g5222.t1
ATGGTTCACTTCTCCACTATTGCCCTGGCACTGGCCAGTGTTCTTCCTCAGCTGACCAATGCATCCGGATTGAAC
ACCGCTGCTGTCGCAAAGGGAAAGCTATACTTCGGATCAGCTACTGATAACTCCGAGTTGACGGATACCGCATAC
CTTGCCCAGCTGAGCAACACAGACGACTTTGGACAGATTACACCCGGTAATGCGCAGAAGTGGGATGCAACCGAA
CCGTCTCAGAACACCTTTTCCTATACCAAAGGAGATGTCATTGCCAACCTCGCTGCTACGAATGGCCAAAAGCTG
CGATGCCATACTCTAGTTTGGTATAGCCAGTTGCCCAGCTGGGTCTCAAGCGGCTCCTGGACGAACGCGACTCTG
CTTGCCGCCATGAAGAACCACATCACCAACGTGGTGACTCACTACAAAGGCAAATGCTATGCTTGGGATGTTGCC
AACGAAGCTCTCAACGAGGACGGCACCTACCGTGACAACGTCTTCTACCAATACATCGGCGAGGCATACCTTCCC
ATCGCATTCGCTACAGCAGCCGCCGCAGACCCAGACGCCAAGCTCTACTACAACGACTACAACATCGAATCCGCC
GGGTCCAAGGCAACAGGTGCCCAGAGAATCGTCAAGCTGGTACAGCAGTACGGCGCCAAGATTGACGGTGTCGGT
CTACAAGCACATTTTATCGTCGGAAGTACCCCTAGCCAGAGCGCGCAGACTACCAATCTGGCCGCGTTCACGGCC
CTGGGCGTCGAAGTTGCCTATACTGAGCTTGATATCCGGATGACTCTCCCGTCGACTTCGGCCCTGCTTGCGCAG
CAGTCGACCGATTACCAGAACACCGTTGCGGCTTGTGTGGCAAATGCTAAGTGTGTGGGCGTTACTATTTGGGAC
TACACGGACAAGTACTCGTGGGTTCCTAGTACATTCTCTGGTCAGGGTGCTGCGTGTCCTTGGGATGCGAATCTG
GTGAAGAAGCCGGCTTATGATGGTATCTTGGCTGCTTTGGGTGGTACAGCTTCTGGTACTTCCACTTCCTCTACG
GCTACCGTTACCAGCACGACTACCTCTGCTACCACCACGACTACCTCTGCTACCACCACGACTACCTCTGCTACC
ACCACGACTACCTCTGCTACCACCACGACTACCAGCTCTGGTAGCACTACTGGTGTCCCTCTCTATGGTCAGTGT
GGTGGGTTGGGCTGGACTGGAAGCACAACTTGCACAAGTGGAACCTGTAAATACTCCAATGACTGGTACTCGCAG
TGCCTATAG
Gene >Pro_DTO377G3_2|g5222.t1
ATGGTTCACTTCTCCACTATTGCCCTGGCACTGGCCAGTGTTCTTCCTCAGCTGTATGGTTGATCTTCCAATTCC
CAGCACGGTGGCAGTTGATAGTGACTAATGCCCATTCTCAATAGGACCAATGCATCCGGATTGAACACCGCTGCT
GTCGCAAAGGGAAAGCTATACTTCGGATCAGCTACTGATAACTCCGAGTTGACGGATACCGCATACCTTGCCCAG
CTGAGCAACACAGACGACTTTGGACAGATTACACCCGGTAATGCGCAGAAGGTTGGGCTGGTCTTAGCGTAATAT
TCCAACATCGCTAATCGTCGCTAGTGGGATGCAACCGAACCGTCTCAGAACACCTTTTCCTATACCAAAGGAGAT
GTCATTGCCAACCTCGCTGCTACGAATGGCCAAAAGCTGCGATGCCATACTCTAGTTTGGTATAGCCAGTTGCCC
AGCTGGGGTAAGTTCTGTTATCTCATGTCTTTCAATGCGGGAATATCCATCTAATGATAACCAGTCTCAAGCGGC
TCCTGGACGAACGCGACTCTGCTTGCCGCCATGAAGAACCACATCACCAACGTGGTGACTCACTACAAAGGCAAA
TGCTATGCTTGGGATGTTGCCAACGAAGGTCAGTGCCGAACTAGGAACGAATCATATCATCACAAGTCGCCTAAT
TTATGGACTACTAGCTCTCAACGAGGACGGCACCTACCGTGACAACGTCTTCTACCAATACATCGGCGAGGCATA
CCTTCCCATCGCATTCGCTACAGCAGCCGCCGCAGACCCAGACGCCAAGCTCTACTACAACGACTACAACATCGA
ATCCGCCGGGTCCAAGGCAACAGGTGCCCAGAGAATCGTCAAGCTGGTACAGCAGTACGGCGCCAAGATTGACGG
TGTCGGTCTACAAGCACATTTTATCGTCGGAAGTACCCCTAGCCAGAGCGCGCAGACTACCAATCTGGCCGCGTT
CACGGCCCTGGGCGTCGAAGTTGCCTATACTGAGCTTGATATCCGGATGACTCTCCCGTCGACTTCGGCCCTGCT
TGCGCAGCAGTCGACCGATTACCAGAACACCGTTGCGGCTTGTGTGGCAAATGCTAAGTGTGTGGGCGTTACTAT
TTGGGACTACACGGACAAGTACTCGTGGGTTCCTAGTACATTCTCTGGTCAGGGTGCTGCGTGTCCTTGGGATGC
GAATCTGGTGAAGAAGCCGGCTTATGATGGTATCTTGGCTGCTTTGGGTGGTACAGCTTCTGGTACTTCCACTTC
CTCTACGGCTACCGTTACCAGCACGACTACCTCTGCTACCACCACGACTACCTCTGCTACCACCACGACTACCTC
TGCTACCACCACGACTACCTCTGCTACCACCACGACTACCAGCTCTGGTAGCACTACTGGTGTCCCTCTCTATGG
TCAGTGTGGTGGGTTGGGCTGGACTGGAAGCACAACTTGCACAAGTGGAACCTGTAAATACTCCAATGACTGGTA
CTCGCAGTGCCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail