Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5196.t1
Gene name
Locationscaffold_12:147510..148703
Strand-
Gene length (bp)1193
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 2.6E-19 31 117
PF00153 Mito_carr Mitochondrial carrier protein 1.0E-18 131 225
PF00153 Mito_carr Mitochondrial carrier protein 4.0E-16 237 322

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 86 108 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 101.52 61.05 141.98
5d_25C Five days - 25 degrees Celsius 66.90 39.02 94.78
7d_25C Seven days - 25 degrees Celsius 63.95 37.08 90.83
10d_25C Ten days - 25 degrees Celsius 71.34 42.01 100.66
7d_15C Seven days - 15 degrees Celsius 86.83 51.83 121.83
7d_30C Seven days - 30 degrees Celsius 49.43 27.44 71.42

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.059864 no
3d_25C 7d_25C 0.034125 yes
3d_25C 7d_15C 0.561458 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.118550 no
5d_25C 7d_25C 0.896524 no
5d_25C 7d_15C 0.289194 no
5d_25C 7d_30C 0.231396 no
5d_25C 10d_25C 0.844075 no
7d_25C 7d_15C 0.187022 no
7d_25C 7d_30C 0.318959 no
7d_25C 10d_25C 0.720723 no
7d_15C 7d_30C 0.008133 yes
7d_15C 10d_25C 0.448082 no
7d_30C 10d_25C 0.119453 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5196.t1
MSSSTSPTAQQLENEINDIETKAVNQTIVQLRSLAAGAVGGLCAVVVGHPFDLVKVRLQTAEKGVYSGAMDVVRK
TVAREGLARGLYAGVSAPLVGVTPMFAVSFWGYDVGKTLVSKFSTVPVKNDTPQYSIAQISSAGFFSAIPMTLIT
APFERVKVLLQIQGQKQLAPGEKPQYSGGLDVVRQLYKEGGVRSVFRGSAMTLARDGPGSAAYFAAYEYIKRSLT
PKDAEGNVTGELSLSAVVCAGGAAGIAMWIPVFPVDTIKSRLQSAPGKPTMGGVIRSVYASGGLKAFFPGFGPAL
ARAVPANAATFLGVELAHKGMKKLFD*
Coding >Pro_DTO377G3_2|g5196.t1
ATGTCTTCCTCTACCTCCCCCACCGCGCAGCAGCTTGAGAATGAGATCAACGACATCGAGACCAAGGCCGTCAAC
CAGACAATTGTACAGCTGCGCTCTCTCGCAGCCGGTGCCGTTGGTGGTCTCTGCGCTGTCGTCGTTGGACACCCG
TTTGATCTAGTCAAGGTGCGCCTGCAGACGGCCGAAAAGGGAGTTTACTCAGGTGCCATGGATGTGGTCCGGAAG
ACGGTAGCCCGTGAAGGATTGGCTCGAGGATTGTATGCCGGTGTCTCTGCGCCGCTTGTTGGAGTTACTCCCATG
TTTGCCGTCAGCTTTTGGGGTTACGACGTGGGCAAGACTCTCGTGAGCAAGTTCTCTACCGTCCCAGTCAAGAAC
GACACCCCGCAGTACTCCATCGCACAAATCTCTTCTGCAGGCTTCTTCTCCGCCATCCCCATGACCCTGATCACG
GCACCCTTCGAGCGTGTCAAGGTCCTCCTCCAGATCCAGGGCCAGAAGCAACTGGCTCCGGGCGAGAAACCTCAG
TACTCCGGTGGTCTGGATGTCGTGCGCCAGCTGTACAAGGAAGGTGGTGTTCGCAGCGTGTTCCGTGGTAGCGCC
ATGACGTTGGCCCGTGATGGTCCCGGCTCGGCCGCCTACTTCGCGGCCTACGAGTACATCAAGCGCTCCTTGACC
CCCAAGGATGCCGAAGGCAACGTGACGGGCGAGCTCTCCCTATCTGCCGTTGTGTGCGCTGGTGGTGCTGCCGGT
ATCGCTATGTGGATCCCTGTCTTCCCCGTTGACACCATCAAGTCCCGCCTGCAGAGCGCACCGGGCAAGCCTACC
ATGGGTGGTGTTATCCGCTCGGTTTACGCTAGCGGCGGTTTGAAGGCCTTCTTCCCTGGATTCGGACCTGCTCTC
GCCCGTGCGGTGCCTGCCAATGCCGCCACTTTCCTCGGCGTTGAGCTGGCACACAAGGGCATGAAGAAGTTATTT
GACTAA
Transcript >Pro_DTO377G3_2|g5196.t1
ATGTCTTCCTCTACCTCCCCCACCGCGCAGCAGCTTGAGAATGAGATCAACGACATCGAGACCAAGGCCGTCAAC
CAGACAATTGTACAGCTGCGCTCTCTCGCAGCCGGTGCCGTTGGTGGTCTCTGCGCTGTCGTCGTTGGACACCCG
TTTGATCTAGTCAAGGTGCGCCTGCAGACGGCCGAAAAGGGAGTTTACTCAGGTGCCATGGATGTGGTCCGGAAG
ACGGTAGCCCGTGAAGGATTGGCTCGAGGATTGTATGCCGGTGTCTCTGCGCCGCTTGTTGGAGTTACTCCCATG
TTTGCCGTCAGCTTTTGGGGTTACGACGTGGGCAAGACTCTCGTGAGCAAGTTCTCTACCGTCCCAGTCAAGAAC
GACACCCCGCAGTACTCCATCGCACAAATCTCTTCTGCAGGCTTCTTCTCCGCCATCCCCATGACCCTGATCACG
GCACCCTTCGAGCGTGTCAAGGTCCTCCTCCAGATCCAGGGCCAGAAGCAACTGGCTCCGGGCGAGAAACCTCAG
TACTCCGGTGGTCTGGATGTCGTGCGCCAGCTGTACAAGGAAGGTGGTGTTCGCAGCGTGTTCCGTGGTAGCGCC
ATGACGTTGGCCCGTGATGGTCCCGGCTCGGCCGCCTACTTCGCGGCCTACGAGTACATCAAGCGCTCCTTGACC
CCCAAGGATGCCGAAGGCAACGTGACGGGCGAGCTCTCCCTATCTGCCGTTGTGTGCGCTGGTGGTGCTGCCGGT
ATCGCTATGTGGATCCCTGTCTTCCCCGTTGACACCATCAAGTCCCGCCTGCAGAGCGCACCGGGCAAGCCTACC
ATGGGTGGTGTTATCCGCTCGGTTTACGCTAGCGGCGGTTTGAAGGCCTTCTTCCCTGGATTCGGACCTGCTCTC
GCCCGTGCGGTGCCTGCCAATGCCGCCACTTTCCTCGGCGTTGAGCTGGCACACAAGGGCATGAAGAAGTTATTT
GACTAA
Gene >Pro_DTO377G3_2|g5196.t1
ATGTCTTCCTCTACCTCCCCCACCGCGCAGCAGCTTGAGAATGAGATCAACGACATCGAGACCAAGGCCGTCAAC
CAGACAATTGTACAGCTGCGCTCTCTCGCAGCCGGTGCCGTTGGTGGTCTCTGCGCTGTCGTCGTTGGACACCCG
TTTGATCTAGTCAAGGTGCGCCTGCAGACGGCCGAAAAGGGAGTTTACTCAGGTGCCATGGATGTGGTCCGGAAG
ACGGTAGCCCGTGAAGGATTGGCTCGAGTATGATCACCACAAGCACATTGAATACTTTGCGACCGAACTGACAAT
GGTTCCTAGGGATTGTATGCCGGTGTCTCTGCGCCGCTTGTTGGAGTTACTCCCATGTGTAAGTACTCTAGCATG
CGCCATAATGGCTCTCACATCTGAAATTGATCGAGTTATGAGCTAATCAGTCCTGTCTCACAGTTGCCGTCAGCT
TTTGGGTTCGTCTTTTTTTCTTTTTCTCTGCGCCCGCAGCTGCGAGCGCCCGTCCGGAAGCGATACTAACAACAA
ATTAGGGTTACGACGTGGGCAAGACTCTCGTGAGCAAGTTCTCTACCGTCCCAGTCAAGAACGACACCCCGCAGT
ACTCCATCGCACAAATCTCTTCTGCAGGCTTCTTCTCCGCCATCCCCATGACCCTGATCACGGCACCCTTCGAGC
GTGTCAAGGTCCTCCTCCAGATCCAGGGCCAGAAGCAACTGGCTCCGGGCGAGAAACCTCAGTACTCCGGTGGTC
TGGATGTCGTGCGCCAGCTGTACAAGGAAGGTGGTGTTCGCAGCGTGTTCCGTGGTAGCGCCATGACGTTGGCCC
GTGATGGTCCCGGCTCGGCCGCCTACTTCGCGGCCTACGAGTACATCAAGCGCTCCTTGACCCCCAAGGATGCCG
AAGGCAACGTGACGGGCGAGCTCTCCCTATCTGCCGTTGTGTGCGCTGGTGGTGCTGCCGGTATCGCTATGTGGA
TCCCTGTCTTCCCCGTTGACACCATCAAGTCCCGCCTGCAGAGCGCACCGGGCAAGCCTACCATGGGTGGTGTTA
TCCGCTCGGTTTACGCTAGCGGCGGTTTGAAGGCCTTCTTCCCTGGATTCGGACCTGCTCTCGCCCGTGCGGTGC
CTGCCAATGCCGCCACTTTCCTCGGCGTTGAGCTGGCACACAAGGGCATGAAGAAGTTATTTGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail