Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5187.t1
Gene name
Locationscaffold_12:129142..130547
Strand+
Gene length (bp)1405
Transcript length (bp)1293
Coding sequence length (bp)1293
Protein length (aa) 431

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00108 Thiolase_N Thiolase, N-terminal domain 4.2E-89 38 295
PF02803 Thiolase_C Thiolase, C-terminal domain 2.4E-40 306 425
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 4.0E-05 114 153

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0016746 acyltransferase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 90.87 55.89 125.85
5d_25C Five days - 25 degrees Celsius 69.62 42.26 96.98
7d_25C Seven days - 25 degrees Celsius 66.61 40.17 93.04
10d_25C Ten days - 25 degrees Celsius 87.03 53.24 120.82
7d_15C Seven days - 15 degrees Celsius 99.92 61.39 138.46
7d_30C Seven days - 30 degrees Celsius 67.90 41.14 94.66

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.238437 no
3d_25C 7d_25C 0.152787 no
3d_25C 7d_15C 0.732868 no
3d_25C 7d_30C 0.196058 no
3d_25C 10d_25C 0.896978 no
5d_25C 7d_25C 0.889967 no
5d_25C 7d_15C 0.085819 no
5d_25C 7d_30C 0.940770 no
5d_25C 10d_25C 0.359096 no
7d_25C 7d_15C 0.055327 no
7d_25C 7d_30C 0.956077 no
7d_25C 10d_25C 0.247647 no
7d_15C 7d_30C 0.071063 no
7d_15C 10d_25C 0.609021 no
7d_30C 10d_25C 0.305440 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5187.t1
MISAGMSARLPKRVFPAFCPQRQFSSARPTCKEIQEAYILSASRTPTTKFNGSFASVSAPELGAVAIKSALAKSK
VPIEKITDVYMGNVLQGSVGQAPARQASIFAGLPSTVEATTINKVCASGLKAVSLAAQNIQLGLAEAQVAGGMEN
MSRVPYYMARASQLPPFGEIKLEDGLIKDGLWDVYNNFHMGICAEHTAKNHSVSREEQDLYAIQSYERAQQAWKE
NKFADEIAAVTVKGKKGDTIVDRDEGFENLRIDKLKGLKPAFLRDGSGTVTAGNASSMNDGASALILGNRDIARK
YGGGSRVLARIVSSADAAVDPVDFPVAPSKAVPLALERAGITKDQVAVWEFNEAFAAVIKANEKILGLQNAKVNM
LGGAISLGHPLGSSGSRILVTLLHQLQPGEYGVAAICNGGGAATAMVVQRLDRVD*
Coding >Pro_DTO377G3_2|g5187.t1
ATGATTTCCGCAGGCATGTCTGCTCGTCTCCCCAAACGGGTCTTCCCCGCATTTTGCCCCCAGCGACAGTTCAGC
TCTGCACGCCCGACATGCAAGGAGATTCAGGAAGCTTACATTCTGAGTGCATCTCGAACACCAACGACAAAGTTC
AATGGTTCTTTTGCATCCGTATCAGCACCTGAGCTTGGCGCTGTTGCAATAAAATCCGCCCTAGCCAAGTCCAAG
GTACCTATTGAGAAGATCACGGATGTGTATATGGGAAATGTTTTGCAGGGCTCAGTAGGCCAGGCACCTGCCCGT
CAGGCGTCTATATTTGCCGGTCTCCCTTCCACTGTTGAAGCCACAACAATCAACAAGGTCTGCGCTTCTGGCTTG
AAGGCTGTGTCACTTGCCGCACAAAATATTCAACTTGGCTTGGCAGAGGCACAAGTGGCTGGTGGTATGGAGAAC
ATGAGTCGCGTCCCCTATTATATGGCACGTGCCAGCCAATTGCCACCCTTTGGTGAGATCAAGCTAGAGGATGGT
CTCATCAAGGATGGTTTATGGGATGTTTACAACAATTTCCACATGGGTATCTGCGCAGAACATACTGCGAAGAAC
CACAGCGTCTCGCGGGAGGAGCAGGATTTATATGCCATCCAGTCATACGAGCGCGCTCAGCAGGCATGGAAGGAG
AACAAGTTCGCCGACGAGATTGCCGCGGTTACTGTGAAGGGCAAGAAAGGAGATACCATTGTCGACCGGGATGAG
GGCTTCGAAAACTTGCGTATCGACAAGTTGAAGGGCCTGAAACCCGCCTTTCTACGAGATGGGAGTGGTACTGTA
ACCGCTGGCAACGCATCTAGCATGAATGACGGAGCATCCGCTCTGATCTTGGGCAACAGGGATATTGCTCGCAAG
TATGGCGGTGGCAGCCGTGTCTTGGCCCGTATTGTTTCTTCGGCCGATGCTGCCGTTGACCCTGTAGACTTCCCA
GTGGCCCCTTCCAAAGCAGTTCCCCTGGCGCTGGAGCGTGCTGGAATCACCAAGGACCAAGTGGCGGTATGGGAA
TTCAACGAGGCTTTTGCGGCTGTCATCAAAGCCAATGAAAAGATTCTCGGTTTGCAGAACGCCAAAGTCAACATG
CTTGGAGGCGCCATCTCTCTCGGCCACCCTCTTGGCAGCTCAGGCTCACGTATCCTCGTCACCTTGCTCCACCAA
TTGCAGCCCGGCGAGTATGGAGTGGCTGCGATCTGCAACGGCGGCGGTGCTGCAACTGCGATGGTTGTGCAGAGA
TTGGATCGGGTGGATTGA
Transcript >Pro_DTO377G3_2|g5187.t1
ATGATTTCCGCAGGCATGTCTGCTCGTCTCCCCAAACGGGTCTTCCCCGCATTTTGCCCCCAGCGACAGTTCAGC
TCTGCACGCCCGACATGCAAGGAGATTCAGGAAGCTTACATTCTGAGTGCATCTCGAACACCAACGACAAAGTTC
AATGGTTCTTTTGCATCCGTATCAGCACCTGAGCTTGGCGCTGTTGCAATAAAATCCGCCCTAGCCAAGTCCAAG
GTACCTATTGAGAAGATCACGGATGTGTATATGGGAAATGTTTTGCAGGGCTCAGTAGGCCAGGCACCTGCCCGT
CAGGCGTCTATATTTGCCGGTCTCCCTTCCACTGTTGAAGCCACAACAATCAACAAGGTCTGCGCTTCTGGCTTG
AAGGCTGTGTCACTTGCCGCACAAAATATTCAACTTGGCTTGGCAGAGGCACAAGTGGCTGGTGGTATGGAGAAC
ATGAGTCGCGTCCCCTATTATATGGCACGTGCCAGCCAATTGCCACCCTTTGGTGAGATCAAGCTAGAGGATGGT
CTCATCAAGGATGGTTTATGGGATGTTTACAACAATTTCCACATGGGTATCTGCGCAGAACATACTGCGAAGAAC
CACAGCGTCTCGCGGGAGGAGCAGGATTTATATGCCATCCAGTCATACGAGCGCGCTCAGCAGGCATGGAAGGAG
AACAAGTTCGCCGACGAGATTGCCGCGGTTACTGTGAAGGGCAAGAAAGGAGATACCATTGTCGACCGGGATGAG
GGCTTCGAAAACTTGCGTATCGACAAGTTGAAGGGCCTGAAACCCGCCTTTCTACGAGATGGGAGTGGTACTGTA
ACCGCTGGCAACGCATCTAGCATGAATGACGGAGCATCCGCTCTGATCTTGGGCAACAGGGATATTGCTCGCAAG
TATGGCGGTGGCAGCCGTGTCTTGGCCCGTATTGTTTCTTCGGCCGATGCTGCCGTTGACCCTGTAGACTTCCCA
GTGGCCCCTTCCAAAGCAGTTCCCCTGGCGCTGGAGCGTGCTGGAATCACCAAGGACCAAGTGGCGGTATGGGAA
TTCAACGAGGCTTTTGCGGCTGTCATCAAAGCCAATGAAAAGATTCTCGGTTTGCAGAACGCCAAAGTCAACATG
CTTGGAGGCGCCATCTCTCTCGGCCACCCTCTTGGCAGCTCAGGCTCACGTATCCTCGTCACCTTGCTCCACCAA
TTGCAGCCCGGCGAGTATGGAGTGGCTGCGATCTGCAACGGCGGCGGTGCTGCAACTGCGATGGTTGTGCAGAGA
TTGGATCGGGTGGATTGA
Gene >Pro_DTO377G3_2|g5187.t1
ATGATTTCCGCAGGCATGTCTGCTCGTCTCCCCAAACGGGTCTTCCCCGCATTTTGCCCCCAGCGACAGTTCAGC
TCTGCACGCCCGACATGCAAGGAGATTCAGGAAGCTTACATTCTGAGTGCATCTCGAACACCAACGACAAAGGTG
GGTACCTTTAGAGAAATCTCCTCTAGAAGAACAATTCGCTAACTCCCAAGGTAGTTCAATGGTTCTTTTGCATCC
GTATCAGCACCTGAGCTTGGCGCTGTTGCAATAAAATCCGCCCTAGCCAAGTCCAAGGTACCTATTGAGAAGATC
ACGGATGTGTATATGGGAAATGTTTTGCAGGGCTCAGTAGGCCAGGCACCTGCCCGTCAGGCGTCTATATTTGCC
GGTCTCCCTTCCACTGTTGAAGCCACAACAATCAACAAGGTCTGCGCTTCTGGCTTGAAGGCTGTGTCACTTGCC
GCACAAAATATTCAACTTGGCTTGGCAGAGGCACAAGTGGCTGGTGGTATGGAGAACATGAGTCGCGTCCCCTAT
TATATGGCACGTGCCAGCCAATTGCCACCCTTTGGTGAGATCAAGCTAGAGGATGGTCTCATCAAGGATGGTTTA
TGGGATGTTTACAACAATTTCCACATGGGTATCTGCGCAGAACATACTGCGAAGAACCACAGCGTCTCGCGGGAG
GAGCAGGATTTATATGCCATCCAGTCATACGAGCGCGCTCAGCAGGCATGGAAGGAGAACAAGTTCGCCGACGAG
ATTGCCGCGGTTACTGTGAAGGGCAAGAAAGGAGATACCATTGTCGACCGGGATGAGGGCTTCGAAAACTTGCGT
ATCGACAAGTTGAAGGGCCTGAAACCCGCCTTTCTACGAGATGGGAGTGGTACTGTAACCGCTGGCAACGCATCT
AGCATGAATGACGGAGCATCCGCTCTGATCTTGGGCAACAGGGATATTGCTCGCAAGTATGGCGGTGGCAGCCGT
GTCTTGGCCCGTATTGTTTCTTCGGCCGATGCTGCCGTTGACCCTGTAGACTTCCCAGTGGCCCCTTCCAAAGCA
GTTCCCCTGGCGCTGGAGCGTGCTGGAATCACCAAGGACCAAGTGGCGGTATGGGAATTCAACGAGGCTTTTGCG
GCTGTCATCAAAGCCAATGAAAAGGTCAGTGCCGTATTTGTCTAACTTCCATACCAGATCTAATTTCTAGCTCCT
ATAGATTCTCGGTTTGCAGAACGCCAAAGTCAACATGCTTGGAGGCGCCATCTCTCTCGGCCACCCTCTTGGCAG
CTCAGGCTCACGTATCCTCGTCACCTTGCTCCACCAATTGCAGCCCGGCGAGTATGGAGTGGCTGCGATCTGCAA
CGGCGGCGGTGCTGCAACTGCGATGGTTGTGCAGAGATTGGATCGGGTGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail