Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5186.t1
Gene name
Locationscaffold_12:127825..128575
Strand-
Gene length (bp)750
Transcript length (bp)459
Coding sequence length (bp)459
Protein length (aa) 153

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00179 UQ_con Ubiquitin-conjugating enzyme 1.1E-51 8 144

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 210.29 123.29 297.29
5d_25C Five days - 25 degrees Celsius 271.46 162.93 379.99
7d_25C Seven days - 25 degrees Celsius 270.04 161.53 378.56
10d_25C Ten days - 25 degrees Celsius 370.69 225.31 516.07
7d_15C Seven days - 15 degrees Celsius 311.72 188.18 435.27
7d_30C Seven days - 30 degrees Celsius 286.97 171.62 402.32

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.291471 no
3d_25C 7d_25C 0.306203 no
3d_25C 7d_15C 0.065980 no
3d_25C 7d_30C 0.177767 no
3d_25C 10d_25C 0.004450 yes
5d_25C 7d_25C 0.988801 no
5d_25C 7d_15C 0.616122 no
5d_25C 7d_30C 0.870796 no
5d_25C 10d_25C 0.170122 no
7d_25C 7d_15C 0.595907 no
7d_25C 7d_30C 0.853335 no
7d_25C 10d_25C 0.164699 no
7d_15C 7d_30C 0.790775 no
7d_15C 10d_25C 0.500566 no
7d_30C 10d_25C 0.287046 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5186.t1
MSTSARRRLMRDFKRMQTDPPAGVSASPVADNVMTWNAVIIGPADTPFEDGTFRLVMNFEEQYPNKPPGVKFISQ
MFHPNVYGTGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNTSSPANVEASNLYKDNRKEYTKRVRETVEKSWE
DN*
Coding >Pro_DTO377G3_2|g5186.t1
ATGTCTACATCCGCCCGTCGTCGTCTGATGCGGGACTTCAAGCGCATGCAAACCGATCCCCCAGCTGGTGTCTCT
GCATCTCCAGTCGCTGATAATGTCATGACATGGAATGCCGTCATCATCGGCCCCGCCGATACACCGTTCGAAGAT
GGCACATTCCGCCTGGTCATGAATTTTGAAGAACAATACCCCAACAAACCCCCGGGTGTGAAATTCATAAGCCAA
ATGTTCCATCCTAATGTGTACGGGACCGGCGAGCTCTGTCTCGATATTCTGCAGAACCGCTGGAGTCCGACATAT
GATGTGGCGGCTATTCTTACTAGTATTCAAAGTCTTCTGAATGACCCCAACACCTCGTCTCCGGCCAACGTCGAG
GCCTCGAACCTCTACAAAGACAACCGTAAAGAGTACACCAAGCGAGTGCGTGAGACGGTCGAGAAAAGCTGGGAG
GACAACTGA
Transcript >Pro_DTO377G3_2|g5186.t1
ATGTCTACATCCGCCCGTCGTCGTCTGATGCGGGACTTCAAGCGCATGCAAACCGATCCCCCAGCTGGTGTCTCT
GCATCTCCAGTCGCTGATAATGTCATGACATGGAATGCCGTCATCATCGGCCCCGCCGATACACCGTTCGAAGAT
GGCACATTCCGCCTGGTCATGAATTTTGAAGAACAATACCCCAACAAACCCCCGGGTGTGAAATTCATAAGCCAA
ATGTTCCATCCTAATGTGTACGGGACCGGCGAGCTCTGTCTCGATATTCTGCAGAACCGCTGGAGTCCGACATAT
GATGTGGCGGCTATTCTTACTAGTATTCAAAGTCTTCTGAATGACCCCAACACCTCGTCTCCGGCCAACGTCGAG
GCCTCGAACCTCTACAAAGACAACCGTAAAGAGTACACCAAGCGAGTGCGTGAGACGGTCGAGAAAAGCTGGGAG
GACAACTGA
Gene >Pro_DTO377G3_2|g5186.t1
ATGTCTACATCCGCCCGTCGTCGTCTGATGCGGGACTTCAAGGTACGCGTCAATATTGTCACCTCGCCTTAGGCT
ATTCGAGACGTTTCTACTGTACCCATAAATAATCTCATATAAAGCTATCCCTATGAGCCCGATTTGCTTCTTAAA
TTCTTCCCCGGTGTTCTGTGTCCAAGATGATTTGCCCCGCTAACATTTCCATACTCACAGCGCATGCAAACCGAT
CCCCCAGCTGGTGTCTCTGCATCTCCAGTCGCTGATAATGTCATGACATGGTATGTGTCTTCCGCGGCATGATTT
GAGGCTCTTGACAATGATTCTGATGAAATGCTAGGAATGCCGTCATCATCGGCCCCGCCGATACACCGTTCGAAG
ATGGCACATTCCGCCTGGTCATGAATTTTGAAGAACAATACCCCAACAAACCCCCGGGTGTGAAATTCATAAGCC
AAATGTTCCATCCTAATGTGTACGGGACCGGCGAGCTCTGTCTCGATATTCTGCAGAACCGCTGGAGTCCGACAT
ATGATGTGGCGGCTATTCTTACTAGTATTCAAAGGTATCGCTGGCTTGTCTATGAAAGATCACTATACAAATTCT
AATGTGCGGCTCGTCAATTCTAGTCTTCTGAATGACCCCAACACCTCGTCTCCGGCCAACGTCGAGGCCTCGAAC
CTCTACAAAGACAACCGTAAAGAGTACACCAAGCGAGTGCGTGAGACGGTCGAGAAAAGCTGGGAGGACAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail