Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5184.t1
Gene name
Locationscaffold_12:122373..123268
Strand+
Gene length (bp)895
Transcript length (bp)573
Coding sequence length (bp)573
Protein length (aa) 191

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00036 EF-hand_1 EF hand 2.3E-06 67 90
PF00036 EF-hand_1 EF hand 3.0E-08 101 126
PF00036 EF-hand_1 EF hand 2.3E-06 149 172
PF13499 EF-hand_7 EF-hand domain pair 2.2E-15 99 171
PF13405 EF-hand_6 EF-hand domain 4.3E-06 66 90
PF13405 EF-hand_6 EF-hand domain 4.8E-05 149 171
PF13202 EF-hand_5 EF hand 1.4E-03 68 85
PF13202 EF-hand_5 EF hand 6.2E-05 104 123
PF13202 EF-hand_5 EF hand 4.2E-04 150 171
PF13833 EF-hand_8 EF-hand domain pair 8.0E-06 39 86
PF13833 EF-hand_8 EF-hand domain pair 4.2E-03 98 123
PF13833 EF-hand_8 EF-hand domain pair 1.6E-02 130 173

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 150.16 89.07 211.26
5d_25C Five days - 25 degrees Celsius 178.32 106.42 250.21
7d_25C Seven days - 25 degrees Celsius 165.79 97.99 233.58
10d_25C Ten days - 25 degrees Celsius 228.56 138.62 318.51
7d_15C Seven days - 15 degrees Celsius 187.63 112.75 262.50
7d_30C Seven days - 30 degrees Celsius 170.31 101.18 239.44

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.519664 no
3d_25C 7d_25C 0.743083 no
3d_25C 7d_15C 0.371276 no
3d_25C 7d_30C 0.659187 no
3d_25C 10d_25C 0.053152 no
5d_25C 7d_25C 0.818443 no
5d_25C 7d_15C 0.877601 no
5d_25C 7d_30C 0.891165 no
5d_25C 10d_25C 0.302138 no
7d_25C 7d_15C 0.666152 no
7d_25C 7d_30C 0.938847 no
7d_25C 10d_25C 0.159178 no
7d_15C 7d_30C 0.745681 no
7d_15C 10d_25C 0.436451 no
7d_30C 10d_25C 0.198175 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5184.t1
MGKSQSKLSPTQLDELQRATHFDKKELQQWYKGFLKDCPSGTLTKEEFQKIYRQFFPFGDPSSFANYVFRVFDSD
NSGMIDFKEFICALSVTSRGKMEDKLDWAFQLYDIDGDGKITYEEMLAIVEAIYKMVGSMVKLPEDEDTPEKRVR
KIFRMMDKDENGSLDIDEFKEGSKRDETIVSALSLYDGLV*
Coding >Pro_DTO377G3_2|g5184.t1
ATGGGAAAGTCTCAATCTAAGCTTTCACCGACGCAGCTCGATGAGCTGCAAAGGGCAACACATTTCGATAAGAAG
GAGCTACAACAATGGTATAAAGGATTTCTCAAGGACTGCCCGTCTGGTACTCTGACCAAGGAGGAGTTTCAGAAA
ATATACCGGCAGTTCTTTCCCTTCGGCGACCCGTCATCCTTTGCCAATTATGTTTTTCGCGTTTTCGACTCGGAC
AACAGTGGTATGATCGATTTCAAAGAATTTATCTGCGCCCTTTCCGTGACTTCGCGAGGCAAGATGGAGGATAAA
CTGGATTGGGCATTCCAATTGTACGATATTGACGGCGATGGGAAAATCACCTATGAAGAAATGCTGGCCATTGTC
GAGGCGATCTATAAGATGGTTGGATCCATGGTGAAACTCCCCGAGGATGAAGATACCCCAGAGAAACGCGTACGA
AAGATCTTCCGCATGATGGACAAGGATGAAAATGGCAGTCTTGACATCGACGAGTTCAAAGAAGGCAGCAAACGG
GATGAAACCATCGTCAGTGCTTTGTCGCTTTACGACGGATTAGTTTAG
Transcript >Pro_DTO377G3_2|g5184.t1
ATGGGAAAGTCTCAATCTAAGCTTTCACCGACGCAGCTCGATGAGCTGCAAAGGGCAACACATTTCGATAAGAAG
GAGCTACAACAATGGTATAAAGGATTTCTCAAGGACTGCCCGTCTGGTACTCTGACCAAGGAGGAGTTTCAGAAA
ATATACCGGCAGTTCTTTCCCTTCGGCGACCCGTCATCCTTTGCCAATTATGTTTTTCGCGTTTTCGACTCGGAC
AACAGTGGTATGATCGATTTCAAAGAATTTATCTGCGCCCTTTCCGTGACTTCGCGAGGCAAGATGGAGGATAAA
CTGGATTGGGCATTCCAATTGTACGATATTGACGGCGATGGGAAAATCACCTATGAAGAAATGCTGGCCATTGTC
GAGGCGATCTATAAGATGGTTGGATCCATGGTGAAACTCCCCGAGGATGAAGATACCCCAGAGAAACGCGTACGA
AAGATCTTCCGCATGATGGACAAGGATGAAAATGGCAGTCTTGACATCGACGAGTTCAAAGAAGGCAGCAAACGG
GATGAAACCATCGTCAGTGCTTTGTCGCTTTACGACGGATTAGTTTAG
Gene >Pro_DTO377G3_2|g5184.t1
ATGGGAAAGTCGTAAGTTCTAACCATCCTCTCACCCTGTTTGAAATGGCGGTGGAACGGACTCCGCGGATCTCAG
GATGCGCGTCATCTCGGGAGCAAGCCAGTACCAAAGGCCCCGTACTTTTGGTCTGAGAATCACGCTGAATACCCT
GCCTACATTCAAAGGAGAACCCTGCGCTGACCCTCGTGTTTCACATTCTACAGTCAATCTAAGCTTTCACCGACG
CAGCTCGATGAGCTGCAAAGGGCAACACATTTCGATAAGAAGGAGCTACAACAATGGTATAAAGGTATGCGGATA
TATGGGAAACATACGAAACATCAAGTCTCAAGAGCGATCGCTGATTATGGGCATGTCTAGGATTTCTCAAGGACT
GCCCGTCTGGTACTCTGACCAAGGAGGAGTTTCAGAAAATATACCGGCAGTTCTTTCCCTTCGGCGACCCGTCAT
CCTTTGCCAATTATGTTTTTCGCGTTTTCGACTCGGACAACAGTGGTATGATCGATTTCAAAGAATTTATCTGCG
CCCTTTCCGTGACTTCGCGAGGCAAGATGGAGGATAAACTGGATTGGGCATTCCAATTGTACGATATTGACGGCG
ATGGGAAAATCACCTATGAAGAAATGCTGGCCATTGTCGAGGCGATCTATAAGATGGTATGCACAATGCAGTTCG
TGAAATCACGATACCCTTAAAAGAACTAATGAGTATACAGGTTGGATCCATGGTGAAACTCCCCGAGGATGAAGA
TACCCCAGAGAAACGCGTACGAAAGATCTTCCGCATGATGGACAAGGATGAAAATGGCAGTCTTGACATCGACGA
GTTCAAAGAAGGCAGCAAACGGGATGAAACCATCGTCAGTGCTTTGTCGCTTTACGACGGATTAGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail