Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5183.t1
Gene name
Locationscaffold_12:119781..121896
Strand+
Gene length (bp)2115
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02990 EMP70 Endomembrane protein 70 3.9E-205 62 603

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 272 294 22
3 347 369 22
4 384 406 22
5 418 440 22
6 455 477 22
7 505 527 22
8 542 564 22
9 577 599 22
10 614 636 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5183.t1
MRFADRAFLLSSTLLAIPSLTTAFYLPGVAPTSYDEGQAVPLYVNHLTPSLSRDDQLHSVFSYDYYHPAFGFCRP
ADGPKDVRESLGSILFGDRIRTSPFELHMAKNETCKSICAEAKFDARSAKWTNRRIAQGYNINWIVDGLPAAQLN
YDGVTKTKFYNPGFSLGELDDNGQALLNNHYDIVIDYHKVGFGGKDKYRVVGVLVQPESRKDSRNLEGGAAECGT
PGNVLALNEDGETTVTWTYSVYWKESPTAWATRWDKYLHVYDPKIHWFSLINSAVFVVFLVGMVSMILVRALKKD
IARYNRLDSFNLEDLDSTSAAIEDGVQEDSGWKLVHGDVFRCPESPLLLSVMVGNGAQLFMMTGVTVAFALLGLL
SPSNRGFLATAILLISALFGGIGGYVSARVYKTFGGDSWRRNIIMTPLFIPGIIFGTFFILNLFVWAKGSSGAVP
FGTMLALVLIWFVISVPLSVAGSWLGFKQSPLEGPTKTNQIPRQVPPMAGSLRTIPSILLTGILPFGAIFVELYF
IMTSLWTNKIYYMFGFLFLCYGLMIITSAATTVLLVYFLLCAENYRWHWRAFIGAGMTGGYVFLNALIFWATRVS
FGGLTGAVLYVGYSALIAFIVFILTGSIGFFASWAFIHRIYGSIKVD*
Coding >Pro_DTO377G3_2|g5183.t1
ATGCGGTTCGCCGATCGAGCCTTTCTTCTCTCGTCGACCCTACTAGCAATCCCTTCTTTGACTACGGCCTTTTAT
CTGCCGGGTGTTGCGCCGACCTCCTACGACGAAGGACAAGCAGTTCCGCTTTATGTCAACCACCTCACCCCCAGC
CTCTCTCGCGATGACCAGCTTCATTCGGTCTTCTCATATGACTACTATCATCCGGCTTTTGGATTCTGCCGACCA
GCAGATGGTCCTAAAGATGTGAGGGAATCCCTGGGGAGCATTCTATTCGGTGACCGCATTCGCACCTCGCCATTC
GAGCTTCACATGGCAAAGAATGAGACCTGCAAATCGATATGTGCAGAGGCCAAATTCGACGCCCGCAGCGCAAAG
TGGACCAATCGACGAATAGCTCAGGGCTACAACATTAACTGGATTGTGGATGGGCTGCCAGCCGCGCAGTTGAAC
TATGACGGCGTTACCAAGACCAAATTTTATAACCCTGGCTTCTCTCTGGGTGAGCTAGATGACAATGGGCAGGCT
CTGCTCAACAATCACTATGACATTGTGATTGATTACCATAAGGTGGGCTTTGGCGGCAAGGATAAATATCGCGTG
GTTGGAGTGCTTGTCCAGCCTGAGTCTCGCAAGGACTCCCGGAATTTAGAAGGCGGGGCCGCTGAATGTGGTACC
CCGGGCAATGTTCTCGCGCTCAATGAGGACGGCGAGACCACAGTCACCTGGACGTATAGTGTGTACTGGAAGGAG
TCCCCCACAGCCTGGGCTACCCGGTGGGATAAGTATCTTCATGTCTATGACCCTAAAATCCACTGGTTCTCTCTC
ATCAACTCGGCTGTCTTTGTGGTTTTCCTCGTGGGTATGGTCAGCATGATTCTAGTCCGCGCGCTCAAGAAGGAT
ATTGCTCGCTATAACAGGCTGGATTCGTTCAACCTGGAGGATTTGGATAGCACTTCGGCTGCGATCGAAGATGGA
GTCCAGGAGGATTCTGGCTGGAAGTTGGTCCATGGCGATGTCTTCCGGTGCCCCGAATCTCCGTTGCTGCTGAGT
GTGATGGTTGGCAACGGCGCCCAGCTATTTATGATGACTGGTGTGACTGTCGCATTTGCCCTGCTTGGTCTCCTC
TCTCCTTCCAACCGCGGATTCCTGGCTACTGCCATTCTCCTAATTTCCGCCCTTTTCGGTGGGATCGGTGGTTAT
GTGTCGGCGCGAGTGTACAAGACATTTGGTGGCGATTCTTGGAGGCGCAACATTATCATGACACCTCTATTTATA
CCTGGCATTATATTCGGTACTTTCTTCATCCTGAATCTCTTTGTTTGGGCCAAGGGATCTAGCGGTGCCGTACCA
TTTGGAACTATGTTGGCACTGGTATTGATTTGGTTTGTTATCAGCGTGCCATTGAGCGTGGCAGGCAGTTGGTTG
GGCTTTAAGCAATCGCCGCTTGAGGGTCCTACCAAGACGAACCAAATTCCTCGACAGGTTCCTCCGATGGCTGGT
AGCCTGCGCACAATTCCATCGATTCTGCTGACCGGAATTCTCCCCTTTGGTGCGATTTTCGTCGAGTTGTACTTT
ATAATGACCTCCCTCTGGACCAACAAGATCTACTACATGTTCGGATTCCTGTTCCTCTGCTACGGCTTGATGATC
ATTACCTCTGCGGCTACTACCGTCTTGCTGGTGTATTTCTTGTTGTGTGCAGAGAACTACCGGTGGCACTGGCGC
GCCTTCATAGGCGCGGGTATGACCGGAGGATATGTCTTTTTGAATGCGCTCATTTTCTGGGCGACACGGGTCAGC
TTTGGTGGATTAACGGGGGCAGTGCTTTATGTGGGCTATTCGGCGCTGATCGCCTTCATTGTGTTTATTCTGACT
GGCTCCATTGGTTTCTTCGCCAGTTGGGCATTCATCCACCGCATCTATGGCTCGATCAAGGTGGACTAA
Transcript >Pro_DTO377G3_2|g5183.t1
ATGCGGTTCGCCGATCGAGCCTTTCTTCTCTCGTCGACCCTACTAGCAATCCCTTCTTTGACTACGGCCTTTTAT
CTGCCGGGTGTTGCGCCGACCTCCTACGACGAAGGACAAGCAGTTCCGCTTTATGTCAACCACCTCACCCCCAGC
CTCTCTCGCGATGACCAGCTTCATTCGGTCTTCTCATATGACTACTATCATCCGGCTTTTGGATTCTGCCGACCA
GCAGATGGTCCTAAAGATGTGAGGGAATCCCTGGGGAGCATTCTATTCGGTGACCGCATTCGCACCTCGCCATTC
GAGCTTCACATGGCAAAGAATGAGACCTGCAAATCGATATGTGCAGAGGCCAAATTCGACGCCCGCAGCGCAAAG
TGGACCAATCGACGAATAGCTCAGGGCTACAACATTAACTGGATTGTGGATGGGCTGCCAGCCGCGCAGTTGAAC
TATGACGGCGTTACCAAGACCAAATTTTATAACCCTGGCTTCTCTCTGGGTGAGCTAGATGACAATGGGCAGGCT
CTGCTCAACAATCACTATGACATTGTGATTGATTACCATAAGGTGGGCTTTGGCGGCAAGGATAAATATCGCGTG
GTTGGAGTGCTTGTCCAGCCTGAGTCTCGCAAGGACTCCCGGAATTTAGAAGGCGGGGCCGCTGAATGTGGTACC
CCGGGCAATGTTCTCGCGCTCAATGAGGACGGCGAGACCACAGTCACCTGGACGTATAGTGTGTACTGGAAGGAG
TCCCCCACAGCCTGGGCTACCCGGTGGGATAAGTATCTTCATGTCTATGACCCTAAAATCCACTGGTTCTCTCTC
ATCAACTCGGCTGTCTTTGTGGTTTTCCTCGTGGGTATGGTCAGCATGATTCTAGTCCGCGCGCTCAAGAAGGAT
ATTGCTCGCTATAACAGGCTGGATTCGTTCAACCTGGAGGATTTGGATAGCACTTCGGCTGCGATCGAAGATGGA
GTCCAGGAGGATTCTGGCTGGAAGTTGGTCCATGGCGATGTCTTCCGGTGCCCCGAATCTCCGTTGCTGCTGAGT
GTGATGGTTGGCAACGGCGCCCAGCTATTTATGATGACTGGTGTGACTGTCGCATTTGCCCTGCTTGGTCTCCTC
TCTCCTTCCAACCGCGGATTCCTGGCTACTGCCATTCTCCTAATTTCCGCCCTTTTCGGTGGGATCGGTGGTTAT
GTGTCGGCGCGAGTGTACAAGACATTTGGTGGCGATTCTTGGAGGCGCAACATTATCATGACACCTCTATTTATA
CCTGGCATTATATTCGGTACTTTCTTCATCCTGAATCTCTTTGTTTGGGCCAAGGGATCTAGCGGTGCCGTACCA
TTTGGAACTATGTTGGCACTGGTATTGATTTGGTTTGTTATCAGCGTGCCATTGAGCGTGGCAGGCAGTTGGTTG
GGCTTTAAGCAATCGCCGCTTGAGGGTCCTACCAAGACGAACCAAATTCCTCGACAGGTTCCTCCGATGGCTGGT
AGCCTGCGCACAATTCCATCGATTCTGCTGACCGGAATTCTCCCCTTTGGTGCGATTTTCGTCGAGTTGTACTTT
ATAATGACCTCCCTCTGGACCAACAAGATCTACTACATGTTCGGATTCCTGTTCCTCTGCTACGGCTTGATGATC
ATTACCTCTGCGGCTACTACCGTCTTGCTGGTGTATTTCTTGTTGTGTGCAGAGAACTACCGGTGGCACTGGCGC
GCCTTCATAGGCGCGGGTATGACCGGAGGATATGTCTTTTTGAATGCGCTCATTTTCTGGGCGACACGGGTCAGC
TTTGGTGGATTAACGGGGGCAGTGCTTTATGTGGGCTATTCGGCGCTGATCGCCTTCATTGTGTTTATTCTGACT
GGCTCCATTGGTTTCTTCGCCAGTTGGGCATTCATCCACCGCATCTATGGCTCGATCAAGGTGGACTAA
Gene >Pro_DTO377G3_2|g5183.t1
ATGCGGTTCGCCGATCGAGCCTTTCTTCTCTCGTCGACCCTACTAGCAATCCCTTCTTTGACTACGGCCTTTTAT
CTGCCGGGTGTTGCGCCGACCTCCTACGACGAAGGACAAGCAGTTCCGCTTTATGTCAACCACCTCACCCCCAGC
CTCTCTCGCGATGACCAGCTTCATTCGGTCTTCTCATATGACTACTATCATCCGGCTTTTGGATTCTGCCGACCA
GCAGATGGTCCTAAAGATGTGAGGGAATCCCTGGGGAGCATTCTATTCGGTGACCGCATTCGCACCTCGCCATTC
GAGCTTCACATGGCAAAGAATGAGACCTGCAAATCGATATGTGCAGAGGCCAAATTCGACGCCCGCAGCGCAAAG
TGGACCAATCGACGAATAGCTCAGGGCTACAACATTAACTGGATTGTGGATGGGCTGCCAGCCGCGCAGTTGAAC
TATGACGGCGTTACCAAGACCAAATTTTATAACCCTGGCTTCTCTCTGGGTGAGCTAGATGACAATGGGCAGGCT
CTGCTCAACAATCACTATGACATTGTGATTGATTACCATAAGGTGGGCTTTGGCGGCAAGGATAAATATCGCGTG
GTTGGAGTGCTTGTCCAGCCTGAGTCTCGCAAGGACTCCCGGAATTTAGAAGGCGGGGCCGCTGAATGTGGTACC
CCGGGCAATGTTCTCGCGCTCAATGAGGACGGCGAGACCACAGTCACCTGGACGTATAGTGTGTACTGGAAGGAG
TCCCCCACAGCCTGGGCTACCCGGTGGGATAAGTATCTTCATGTCTATGACCCTAAAATCCACTGGTTCTCTCTC
ATCAACTCGGCTGTCTTTGTGGTTTTCCTCGTGGGTATGGTCAGCATGATTCTAGTCCGCGCGCTCAAGAAGGAT
ATTGCTCGCTATAACAGGCTGGATTCGTTCAACCTGGAGGATTTGGATAGCACTTCGGCTGCGATCGAAGATGGA
GTCCAGGAGGATTCTGGCTGGAAGTTGGTCCATGGCGATGTCTTCCGGTGCCCCGAATCTCCGTTGCTGCTGAGT
GTGATGGTTGGCAACGGCGCCCAGCTATTTATGATGACTGGTGTGACTGTCGGTGAGTAGTCTGACTCCCGCTCT
TCTTCTCTTTGTACTGATTTTTATTTGTAGCATTTGCCCTGCTTGGTCTCCTCTCTCCTTCCAACCGCGGATTCC
TGGCTACTGCCATTCTCCTAATTTCCGCCCTTTTCGGTGGGATCGGTGGTTATGTGTCGGCGCGAGTGTACAAGA
CATTTGGTGGCGATTCTTGGAGGCGCAACATTATCATGACACCTCTATTTATACCTGGCATTATATTCGGTACTT
TCTTCATCCTGAATCTCTTTGTTTGGGCCAAGGGATCTAGCGGTGCCGTACCATTTGGAACTATGTTGGCACTGG
TATTGATTTGGTTTGTTATCAGCGTGCCATTGAGCGTGGCAGGCAGTTGGTTGGGCTTTAAGCAATCGGTACTAT
CAAATTCCAATCCCGTTATCCAGACATTCCGATGACTAACTTCATTTCCCAATAGCCGCTTGAGGGTCCTACCAA
GACGAACCAAATTCCTCGACAGGTTCCTCCGATGGCTGGTAGCCTGCGCACAATTCCATCGATTCTGCTGACCGG
AATTCTCCCCTTTGGTGCGATTTTCGTCGAGTTGTACTTTATAATGACCTCCCTCTGGACCAACAAGATCTACTA
CATGTTCGGATTCCTGTTCCTCTGCTACGGCTTGATGATCATTACCTCTGCGGCTACTACCGTCTTGCTGGTGTA
TTTCTTGTTGTGTGCAGAGAACTACCGGTGGCACTGGCGCGCCTTCATAGGCGCGGGTATGACCGGAGGATATGT
CTTTTTGAATGCGCTCATTTTCTGGGCGACACGGGTCAGCTTTGGTGGATTAACGGGGGCAGTGCTTTATGTGGG
CTATTCGGCGCTGATCGCCTTCATTGTGTTTATTCTGACTGGTATGTTTTTGTTCCCATGTCTTGCGGATGGGCT
TCTTTTGCTGACTTCTCTCCAGGCTCCATTGGTTTCTTCGCCAGTTGGGCATTCATCCACCGCATCTATGGCTCG
ATCAAGGTGGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail