Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5181.t1
Gene name
Locationscaffold_12:117001..117754
Strand-
Gene length (bp)753
Transcript length (bp)636
Coding sequence length (bp)636
Protein length (aa) 212

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 91 110 19
2 154 176 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 365.75 223.20 508.30
5d_25C Five days - 25 degrees Celsius 468.64 282.17 655.11
7d_25C Seven days - 25 degrees Celsius 433.70 258.99 608.42
10d_25C Ten days - 25 degrees Celsius 573.16 342.91 803.41
7d_15C Seven days - 15 degrees Celsius 520.29 305.14 735.43
7d_30C Seven days - 30 degrees Celsius 392.98 232.27 553.69

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.291320 no
3d_25C 7d_25C 0.513396 no
3d_25C 7d_15C 0.115508 no
3d_25C 7d_30C 0.816529 no
3d_25C 10d_25C 0.030434 yes
5d_25C 7d_25C 0.806086 no
5d_25C 7d_15C 0.729228 no
5d_25C 7d_30C 0.496487 no
5d_25C 10d_25C 0.425586 no
7d_25C 7d_15C 0.493016 no
7d_25C 7d_30C 0.739065 no
7d_25C 10d_25C 0.232935 no
7d_15C 7d_30C 0.237381 no
7d_15C 10d_25C 0.742223 no
7d_30C 10d_25C 0.080003 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5181.t1
MENPVADIPTVIRGLTQSPPSFQETVLHRYFTNNVSFTHPFCRVPSFEGSRWWVSKIFQWYKIMSPRIELEIHSI
AFDEDKLKLYVNMSQIFTIWLVPFHVAPVTLTTVLDLTYDSVKSDATTNGDHKLYYISKQEDLYQTSEFVKFIMP
HIGYWIIFGWHLIASLFCLLGVTLLWPILWLEEKRYIPDRFLRGGNWAYNMEKKIPEIKGQ*
Coding >Pro_DTO377G3_2|g5181.t1
ATGGAGAACCCAGTGGCTGATATACCTACCGTTATCCGGGGTCTAACACAGTCGCCGCCATCTTTTCAAGAAACC
GTCCTTCACCGGTATTTTACCAACAATGTATCCTTTACTCATCCATTCTGCCGTGTGCCCAGCTTTGAAGGTAGC
AGATGGTGGGTTTCAAAGATATTTCAATGGTATAAGATCATGTCACCCCGGATCGAGCTAGAGATCCATTCTATT
GCTTTTGATGAAGATAAACTCAAACTCTATGTGAATATGTCACAGATCTTCACCATCTGGCTTGTTCCCTTCCAT
GTCGCTCCGGTGACTCTCACTACGGTCTTGGACCTGACGTACGATTCGGTCAAAAGCGATGCTACGACCAATGGC
GACCACAAGCTTTACTACATTTCCAAGCAAGAAGATCTATATCAAACATCGGAGTTTGTCAAGTTTATCATGCCG
CATATCGGGTATTGGATTATTTTTGGTTGGCATCTCATTGCAAGCCTTTTCTGTCTCCTGGGTGTGACTTTGCTA
TGGCCTATACTCTGGCTAGAGGAGAAGCGTTATATCCCCGATCGCTTTTTGCGAGGGGGAAATTGGGCTTACAAT
ATGGAGAAGAAGATTCCAGAAATTAAAGGGCAATGA
Transcript >Pro_DTO377G3_2|g5181.t1
ATGGAGAACCCAGTGGCTGATATACCTACCGTTATCCGGGGTCTAACACAGTCGCCGCCATCTTTTCAAGAAACC
GTCCTTCACCGGTATTTTACCAACAATGTATCCTTTACTCATCCATTCTGCCGTGTGCCCAGCTTTGAAGGTAGC
AGATGGTGGGTTTCAAAGATATTTCAATGGTATAAGATCATGTCACCCCGGATCGAGCTAGAGATCCATTCTATT
GCTTTTGATGAAGATAAACTCAAACTCTATGTGAATATGTCACAGATCTTCACCATCTGGCTTGTTCCCTTCCAT
GTCGCTCCGGTGACTCTCACTACGGTCTTGGACCTGACGTACGATTCGGTCAAAAGCGATGCTACGACCAATGGC
GACCACAAGCTTTACTACATTTCCAAGCAAGAAGATCTATATCAAACATCGGAGTTTGTCAAGTTTATCATGCCG
CATATCGGGTATTGGATTATTTTTGGTTGGCATCTCATTGCAAGCCTTTTCTGTCTCCTGGGTGTGACTTTGCTA
TGGCCTATACTCTGGCTAGAGGAGAAGCGTTATATCCCCGATCGCTTTTTGCGAGGGGGAAATTGGGCTTACAAT
ATGGAGAAGAAGATTCCAGAAATTAAAGGGCAATGA
Gene >Pro_DTO377G3_2|g5181.t1
ATGGAGAACCCAGGTGCGTTATCGATCTGATATTTTGGATTCATCAGCTAATTCCTTCAGTGGCTGATATACCTA
CCGTTATCCGGGGTCTAACACAGTCGCCGCCATCTTTTCAAGAAACCGTCCTTCACCGGTATTTTACCAACAATG
TATCCTTTACTCATCCATTCTGCCGTGTGCCCAGCTTTGAAGGTAGCAGATGGTGGGTTTCAAAGATATTTCAAT
GGTATAAGATCATGTCACCCCGGATCGAGCTAGAGATCCATTCTATTGGTATGTCAACAGGAAACTTCTAAGGTT
GTGGACTTCATAATTTTGACTTCAGACTCTGATAATTCTTTAGCTTTTGATGAAGATAAACTCAAACTCTATGTG
AATATGTCACAGATCTTCACCATCTGGCTTGTTCCCTTCCATGTCGCTCCGGTGACTCTCACTACGGTCTTGGAC
CTGACGTACGATTCGGTCAAAAGCGATGCTACGACCAATGGCGACCACAAGCTTTACTACATTTCCAAGCAAGAA
GATCTATATCAAACATCGGAGTTTGTCAAGTTTATCATGCCGCATATCGGGTATTGGATTATTTTTGGTTGGCAT
CTCATTGCAAGCCTTTTCTGTCTCCTGGGTGTGACTTTGCTATGGCCTATACTCTGGCTAGAGGAGAAGCGTTAT
ATCCCCGATCGCTTTTTGCGAGGGGGAAATTGGGCTTACAATATGGAGAAGAAGATTCCAGAAATTAAAGGGCAA
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail