Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5177.t1
Gene name
Locationscaffold_12:107907..110111
Strand+
Gene length (bp)2204
Transcript length (bp)1998
Coding sequence length (bp)1998
Protein length (aa) 666

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain 2.9E-35 311 463
PF00149 Metallophos Calcineurin-like phosphoesterase 7.3E-06 24 237

GO

GO Term Description Terminal node
GO:0009166 nucleotide catabolic process Yes
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0019637 organophosphate metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0009056 catabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0044238 primary metabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0044248 cellular catabolic process No
GO:0006793 phosphorus metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046434 organophosphate catabolic process No
GO:0008150 biological_process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901292 nucleoside phosphate catabolic process No
GO:0009058 biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0046700 heterocycle catabolic process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0009987 cellular process No
GO:0044281 small molecule metabolic process No
GO:0034404 nucleobase-containing small molecule biosynthetic process No
GO:0008152 metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5177.t1
MSSIGTDGLSVTYSSDRTGSPDLRLIHYNDVYHVESGSAEPVGGVSRFQSLVNHYRYHPQFAGQPDILTFFSGDA
FNPSIESTITKGRHMVPFLNAVGTDVACVGNHDLDFGVAQFRHLASQCHFPWLLANVLDPALGADTPIADCGKSR
MLTSNGLKIGVLGLGEREWLGTINSLPPDLIYKSASQTARVLAKQLRDEGADLVIAVTHQREPNDYKLANNLSPD
LVDIILGGHDHFYAHAVVNGIHVMRSGTDFKQLSYIEAFRKPDGLPGWDFNIVRRDVVRSIPEDPDMVAMVTRLT
SSLRAKLEKPIGFTVSPLDGRFSTVRQRESNLGNFVCDLMRFYYAADCAMMAGGTIRGDQIYPPGILKLKDLLNC
FPFEDPVVLLRVPGHALLAALENGVSQLPALEGRFSQVSNIKYGFKMDAPSGSRITFARVGGEPIDLQRDYLLAT
RGYMARGKDGFTSLLIQSEGGDVEELVSEENGVLISTILRQYFLSLKVLGKWNRWSASLGRHWSIVHRNLHGEGW
LKPASPKKEKKACDLLNPRPALRRTARSAYYYGRFPEEVEQGTNVIAGDETNGNAMDSDSDEDPEILTSSRPTTN
YVTQPAKSSAEEEYLLQIARRVVRKWMRHAGLQCRTLNTMDGEGEFTPAWTSGISPRLEGRIVVE*
Coding >Pro_DTO377G3_2|g5177.t1
ATGTCAAGCATCGGAACAGACGGTCTTTCCGTCACTTATTCCTCTGACCGAACTGGGTCTCCGGATCTACGCTTG
ATCCACTATAATGATGTCTACCACGTCGAATCTGGCTCTGCAGAGCCTGTCGGTGGGGTGTCTCGGTTCCAATCC
CTTGTAAATCACTACCGTTATCACCCACAGTTCGCCGGGCAGCCCGATATCCTGACCTTCTTCTCCGGCGATGCT
TTCAACCCGAGTATCGAAAGTACAATCACAAAGGGCAGACATATGGTACCGTTCCTCAACGCTGTGGGCACCGAT
GTAGCGTGTGTGGGTAACCATGATCTCGATTTTGGAGTCGCCCAATTCCGCCATTTGGCCAGCCAATGTCACTTT
CCTTGGCTATTAGCGAACGTTCTTGACCCAGCACTAGGGGCGGATACCCCAATAGCCGACTGCGGAAAGTCTCGG
ATGTTGACATCCAATGGGCTCAAGATCGGTGTGTTGGGTCTTGGAGAAAGAGAATGGCTCGGCACAATAAACTCT
CTTCCGCCTGATCTGATCTACAAATCCGCATCCCAAACAGCTCGAGTGCTTGCGAAACAGCTCCGAGATGAAGGA
GCAGATCTCGTCATCGCTGTCACCCACCAACGTGAACCGAACGACTACAAACTGGCTAACAACCTGTCACCTGAT
CTTGTGGACATCATTCTCGGAGGCCATGATCATTTTTACGCCCATGCTGTTGTCAATGGAATCCATGTGATGCGG
TCAGGGACCGACTTCAAACAGTTGAGTTACATTGAGGCTTTCCGCAAACCGGACGGCTTGCCTGGTTGGGATTTC
AATATTGTACGGCGAGATGTTGTTCGCTCAATTCCCGAAGATCCTGATATGGTGGCGATGGTGACCCGCCTAACT
TCCAGCCTCAGGGCTAAACTAGAAAAGCCAATCGGATTTACGGTCAGCCCGCTCGATGGCCGGTTTTCTACTGTG
CGGCAGCGTGAATCTAATTTGGGAAATTTTGTATGTGACCTGATGCGCTTCTACTATGCGGCTGATTGTGCCATG
ATGGCGGGCGGGACAATTCGCGGCGATCAAATCTATCCGCCAGGAATACTGAAGCTGAAGGATCTACTGAACTGC
TTCCCTTTCGAAGACCCCGTGGTGTTGTTGCGCGTTCCAGGCCATGCACTGCTAGCTGCACTCGAGAATGGGGTT
AGCCAGCTTCCTGCACTCGAGGGGCGATTCTCGCAAGTATCCAATATCAAGTACGGGTTTAAAATGGATGCACCG
TCGGGGTCACGAATTACATTCGCCCGTGTTGGCGGCGAGCCTATTGACTTACAACGTGACTATCTTCTCGCCACA
CGCGGGTATATGGCCCGAGGAAAAGACGGGTTCACGTCATTGCTTATCCAATCCGAAGGAGGTGATGTGGAAGAG
CTTGTGTCTGAGGAAAATGGCGTGCTCATCAGTACAATCCTACGGCAATATTTCCTAAGTCTTAAAGTCCTCGGA
AAATGGAACCGCTGGAGCGCCAGCTTAGGTCGGCACTGGAGTATTGTGCATCGTAACCTGCATGGTGAGGGCTGG
CTGAAGCCAGCATCTCCTAAAAAAGAGAAGAAAGCATGCGACCTGCTGAACCCGCGGCCTGCACTCCGGCGGACA
GCCCGGTCAGCATACTACTATGGTCGATTTCCCGAAGAAGTCGAACAGGGCACCAACGTTATCGCCGGGGACGAG
ACGAATGGTAATGCCATGGACTCCGACTCAGACGAGGATCCAGAGATTCTCACATCCTCGCGACCAACCACAAAT
TACGTCACTCAACCAGCGAAATCATCCGCTGAAGAGGAGTATCTTCTACAAATTGCGCGGCGAGTTGTCCGAAAA
TGGATGCGGCACGCAGGTCTGCAGTGCAGGACGTTGAATACTATGGACGGCGAAGGGGAATTCACTCCGGCCTGG
ACGTCGGGAATCTCTCCTCGACTAGAGGGACGCATTGTGGTAGAGTAG
Transcript >Pro_DTO377G3_2|g5177.t1
ATGTCAAGCATCGGAACAGACGGTCTTTCCGTCACTTATTCCTCTGACCGAACTGGGTCTCCGGATCTACGCTTG
ATCCACTATAATGATGTCTACCACGTCGAATCTGGCTCTGCAGAGCCTGTCGGTGGGGTGTCTCGGTTCCAATCC
CTTGTAAATCACTACCGTTATCACCCACAGTTCGCCGGGCAGCCCGATATCCTGACCTTCTTCTCCGGCGATGCT
TTCAACCCGAGTATCGAAAGTACAATCACAAAGGGCAGACATATGGTACCGTTCCTCAACGCTGTGGGCACCGAT
GTAGCGTGTGTGGGTAACCATGATCTCGATTTTGGAGTCGCCCAATTCCGCCATTTGGCCAGCCAATGTCACTTT
CCTTGGCTATTAGCGAACGTTCTTGACCCAGCACTAGGGGCGGATACCCCAATAGCCGACTGCGGAAAGTCTCGG
ATGTTGACATCCAATGGGCTCAAGATCGGTGTGTTGGGTCTTGGAGAAAGAGAATGGCTCGGCACAATAAACTCT
CTTCCGCCTGATCTGATCTACAAATCCGCATCCCAAACAGCTCGAGTGCTTGCGAAACAGCTCCGAGATGAAGGA
GCAGATCTCGTCATCGCTGTCACCCACCAACGTGAACCGAACGACTACAAACTGGCTAACAACCTGTCACCTGAT
CTTGTGGACATCATTCTCGGAGGCCATGATCATTTTTACGCCCATGCTGTTGTCAATGGAATCCATGTGATGCGG
TCAGGGACCGACTTCAAACAGTTGAGTTACATTGAGGCTTTCCGCAAACCGGACGGCTTGCCTGGTTGGGATTTC
AATATTGTACGGCGAGATGTTGTTCGCTCAATTCCCGAAGATCCTGATATGGTGGCGATGGTGACCCGCCTAACT
TCCAGCCTCAGGGCTAAACTAGAAAAGCCAATCGGATTTACGGTCAGCCCGCTCGATGGCCGGTTTTCTACTGTG
CGGCAGCGTGAATCTAATTTGGGAAATTTTGTATGTGACCTGATGCGCTTCTACTATGCGGCTGATTGTGCCATG
ATGGCGGGCGGGACAATTCGCGGCGATCAAATCTATCCGCCAGGAATACTGAAGCTGAAGGATCTACTGAACTGC
TTCCCTTTCGAAGACCCCGTGGTGTTGTTGCGCGTTCCAGGCCATGCACTGCTAGCTGCACTCGAGAATGGGGTT
AGCCAGCTTCCTGCACTCGAGGGGCGATTCTCGCAAGTATCCAATATCAAGTACGGGTTTAAAATGGATGCACCG
TCGGGGTCACGAATTACATTCGCCCGTGTTGGCGGCGAGCCTATTGACTTACAACGTGACTATCTTCTCGCCACA
CGCGGGTATATGGCCCGAGGAAAAGACGGGTTCACGTCATTGCTTATCCAATCCGAAGGAGGTGATGTGGAAGAG
CTTGTGTCTGAGGAAAATGGCGTGCTCATCAGTACAATCCTACGGCAATATTTCCTAAGTCTTAAAGTCCTCGGA
AAATGGAACCGCTGGAGCGCCAGCTTAGGTCGGCACTGGAGTATTGTGCATCGTAACCTGCATGGTGAGGGCTGG
CTGAAGCCAGCATCTCCTAAAAAAGAGAAGAAAGCATGCGACCTGCTGAACCCGCGGCCTGCACTCCGGCGGACA
GCCCGGTCAGCATACTACTATGGTCGATTTCCCGAAGAAGTCGAACAGGGCACCAACGTTATCGCCGGGGACGAG
ACGAATGGTAATGCCATGGACTCCGACTCAGACGAGGATCCAGAGATTCTCACATCCTCGCGACCAACCACAAAT
TACGTCACTCAACCAGCGAAATCATCCGCTGAAGAGGAGTATCTTCTACAAATTGCGCGGCGAGTTGTCCGAAAA
TGGATGCGGCACGCAGGTCTGCAGTGCAGGACGTTGAATACTATGGACGGCGAAGGGGAATTCACTCCGGCCTGG
ACGTCGGGAATCTCTCCTCGACTAGAGGGACGCATTGTGGTAGAGTAG
Gene >Pro_DTO377G3_2|g5177.t1
ATGTCAAGCATCGGAACAGACGGTCTTTCCGTCACTTATTCCTCTGACCGAACTGGGTCTCCGGATCTACGCTTG
ATCCACTATAATGATGTCTACCACGTCGAGTATGCTTGTCTCTCCATCCCTTTCTCCCCCTAGCTTCATAAACTT
CAACCTGGGATGATATTAAATTATCTCGTATAGATCTGGCTCTGCAGAGCCTGTCGGTGGGGTGTCTCGGTTCCA
ATCCCTTGTAAATCACTACCGTTATCACCCACAGTTCGCCGGGCAGCCCGATATCCTGACCTTCTTCTCCGGCGA
TGCTTTCAACCCGAGTATCGAAAGTACAATCACAAAGGGCAGACATATGGTACCGTTCCTCAACGCTGTGGGCAC
CGATGTAGCGTGTGTGGGTGTGAGTATGGCAACCAGCTGCCCGTCAGGCCTACATACACCGCTAATCTGAGCACC
CACCTAGAACCATGATCTCGATTTTGGAGTCGCCCAATTCCGCCATTTGGCCAGCCAATGTCACTTTCCTTGGCT
ATTAGCGAACGTTCTTGACCCAGCACTAGGGGCGGATACCCCAATAGCCGACTGCGGAAAGTCTCGGATGTTGAC
ATCCAATGGGCTCAAGATCGGTGTGTTGGGTCTTGGAGAAAGAGAATGGTATGCGCTCCTAGAATGTATCTTCGG
ATGCTTTCATTCCTTTGCTTACTCGGGTCTACCTTAGGCTCGGCACAATAAACTCTCTTCCGCCTGATCTGATCT
ACAAATCCGCATCCCAAACAGCTCGAGTGCTTGCGAAACAGCTCCGAGATGAAGGAGCAGATCTCGTCATCGCTG
TCACCCACCAACGTGAACCGAACGACTACAAACTGGCTAACAACCTGTCACCTGATCTTGTGGACATCATTCTCG
GAGGCCATGATCATTTTTACGCCCATGCTGTTGTCAATGGAATCCATGTGATGCGGTCAGGGACCGACTTCAAAC
AGTTGAGTTACATTGAGGCTTTCCGCAAACCGGACGGCTTGCCTGGTTGGGATTTCAATATTGTACGGCGAGATG
TTGTTCGCTCAATTCCCGAAGATCCTGATATGGTGGCGATGGTGACCCGCCTAACTTCCAGCCTCAGGGCTAAAC
TAGAAAAGCCAATCGGATTTACGGTCAGCCCGCTCGATGGCCGGTTTTCTACTGTGCGGCAGCGTGAATCTAATT
TGGGAAATTTTGTATGTGACCTGATGCGCTTCTACTATGCGGCTGATTGTGCCATGATGGCGGGCGGGACAATTC
GCGGCGATCAAATCTATCCGCCAGGAATACTGAAGCTGAAGGATCTACTGAACTGCTTCCCTTTCGAAGACCCCG
TGGTGTTGTTGCGCGTTCCAGGCCATGCACTGCTAGCTGCACTCGAGAATGGGGTTAGCCAGCTTCCTGCACTCG
AGGGGCGATTCTCGCAAGTATCCAATATCAAGTACGGGTTTAAAATGGATGCACCGTCGGGGTCACGAATTACAT
TCGCCCGTGTTGGCGGCGAGCCTATTGACTTACAACGTGACTATCTTCTCGCCACACGCGGGTATATGGCCCGAG
GAAAAGACGGGTTCACGTCATTGCTTATCCAATCCGAAGGAGGTGATGTGGAAGAGCTTGTGTCTGAGGAAAATG
GCGTGCTCATCAGTACAATCCTACGGCAATATTTCCTAAGTCTTAAAGTCCTCGGAAAATGGAACCGCTGGAGCG
CCAGCTTAGGTCGGCACTGGAGTATTGTGCATCGTAACCTGCATGGTGAGGGCTGGCTGAAGCCAGCATCTCCTA
AAAAAGAGAAGAAAGCATGCGACCTGCTGAACCCGCGGCCTGCACTCCGGCGGACAGCCCGGTCAGCATACTACT
ATGGTCGATTTCCCGAAGAAGTCGAACAGGGCACCAACGTTATCGCCGGGGACGAGACGAATGGTAATGCCATGG
ACTCCGACTCAGACGAGGATCCAGAGATTCTCACATCCTCGCGACCAACCACAAATTACGTCACTCAACCAGCGA
AATCATCCGCTGAAGAGGAGTATCTTCTACAAATTGCGCGGCGAGTTGTCCGAAAATGGATGCGGCACGCAGGTC
TGCAGTGCAGGACGTTGAATACTATGGACGGCGAAGGGGAATTCACTCCGGCCTGGACGTCGGGAATCTCTCCTC
GACTAGAGGGACGCATTGTGGTAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail